Citrus Sinensis ID: 002581


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-----
MKQWDAPAVRLWNISGNPCSGSALNATDSAFESPDNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDRNFFTGPLPSFIGNLSRLTLLSLAHNVFSGPVPRELGNLKELNLLSLANNNFSGALPPEIGNLAKLEELYIDSCGASGEIPSTFAKLHNMQILRASDAHFTGKIPDFIGNWTKLTALRLQGNSFQGPIPSSLSKLASLESLRISDIYFVSSSLDFVMSLKNLKDLSLRNALITGTIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIDSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSSLQMNLAVNNFTFDGSNISVFPGLQCLQRNFPCNRNAPRYANFSIKCGGPQMRADNIVYEADNSSLSASSYVVTSTEKWAVSNVGLFNEKENPAYVLNTLAQMTGTRTPELYQTSRITPGSLRYYGLGLENGPYKVSLLFAETSILDRSTERWESLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCVPTQGDYGPAISALSAVSAFKPSVSGLPPGTPGNKNHTGMIVGIAVPLGILGLIVISIVFYMRRKKDNDDEEVLVGIESKPNTFSYAELRSATKDFDPSNKLGEGGYGPVYKGTLSDGRVIAVKQLSIASHQGKNQFVNEIATISAVQHRNLVRLYGCCIEGARRLLVYDGYLAPEYAMRGHLTEKADVFSFGVVALEVISGRANSDNSLDTEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGTVISKPSYLTDWDFKDITASFLNEDTPTPSSSIKRRKSKEKSQRENPVDDHSEGTDALVSPVNVTQLTDILAEGR
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccccccccccccccccHHHcccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHccccccccccccccccCCcccHHHHcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccEEEccccEEcccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEECcCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHcccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccHHcccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccccHHHHHHHcccccccccccccccCEEEEECcccccEEEEEEccccccccHHHHHHHHHHHccccccccccEEEcccccccccEEEccccccHHHHcccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccc
MKQWDAPAVRLWNISGNPCSGSALNATDSAFESPDNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDRNFFTGPLPSFIGNLSRLTLLSLAHNVFSGPVPRELGNLKELNLLSLANNNFSGALPPEIGNLAKLEELYIDSCGASGEIPSTFAKLHNMQILRASDAHFTGKIPDFIGNWTKLTALRLQGNSFQGPIPSSLSKLASLESLRISDIYFVSSSLDFVMSLKNLKDLSLRNALITGTIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIDSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSSLQMNLAVNNFTFDGSNISVFPGLQCLQRNFPCNRNAPRYANFSIKCGGPQMRADNIVYEADNSSLSASSYVVTSTEKWAVSNVGLFNEKENPAYVLNTLAQMTGTRTPELYQTSRITPGSLRYYGLGLENGPYKVSLLFAETSILDRSTERWESLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCVPTQGDYGPAISALSAVSAF****************HTGMIVGIAVPLGILGLIVISIVFYMRRKKDND**EVLVGIESKPNTFSYAELRSATKDFDPSNKLGEGGYGPVYKGTLSDGRVIAVKQLSIASHQGKNQFVNEIATISAVQHRNLVRLYGCCIEGARRLLVYDGYLAPEYAMRGHLTEKADVFSFGVVALEVISGRANSDNSLDTEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGTVISKPSYLTDWDFKD*************************************************QL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQWDAPAVRLWNISGNPCSGSALNATDSAFESPDNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDRNFFTGPLPSFIGNLSRLTLLSLAHNVFSGPVPRELGNLKELNLLSLANNNFSGALPPEIGNLAKLEELYIDSCGASGEIPSTFAKLHNMQILRASDAHFTGKIPDFIGNWTKLTALRLQGNSFQGPIPSSLSKLASLESLRISDIYFVSSSLDFVMSLKNLKDLSLRNALITGTIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIDSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSSLQMNLAVNNFTFDGSNISVFPGLQCLQRNFPCNRNAPRYANFSIKCGGPQMRADNIVYEADNSSLSASSYVVTSTEKWAVSNVGLFNEKENPAYVLNTLAQMTGTRTPELYQTSRITPGSLRYYGLGLENGPYKVSLLFAETSILDRSTERWESLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCVPTQGDYGPAISALSAVSAFKPSVSGLPPGTPGNKNHTGMIVGIAVPLGILGLIVISIVFYMRRKKDNDDEEVLVGIESKPNTFSYAELRSATKDFDPSNKLGEGGYGPVYKGTLSDGRVIAVKQLSIASHQGKNQFVNEIATISAVQHRNLVRLYGCCIEGARRLLVYDGYLAPEYAMRGHLTEKADVFSFGVVALEVISGRANSDNSLDTEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGTVISKPSYLTDWDFKDITASFLNEDTPTPSSSIKRRKSKEKSQRENPVDDHSEGTDALVSPVNVTQLTDILAEGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At1g56130 probableC0LGH2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 42-225,248-332
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 42-225,248-332
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 42-225,248-332
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 720-826
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 720-826
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:confident
Coverage over the Query: 66-364
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:probable
Coverage over the Query: 77-402
View the alignment between query and template
View the model in PyMOL
Template: 3G06, chain A
Confidence level:probable
Coverage over the Query: 53-416
View the alignment between query and template
View the model in PyMOL
Template: 2JWP, chain A
Confidence level:probable
Coverage over the Query: 379-406,428-568
View the alignment between query and template
View the model in PyMOL
Template: 3C1X, chain A
Confidence level:probable
Coverage over the Query: 627-732
View the alignment between query and template
View the model in PyMOL
Template: 2EVA, chain A
Confidence level:probable
Coverage over the Query: 643-710
View the alignment between query and template
View the model in PyMOL