Citrus Sinensis ID: 002583

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900----
MNQYKPIFLGTADPNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELLTKVYRLPADRLYATYFGGDEKAGLAPDNEARDIWLKFLPASRVLPFGCKDNFWEMGDTGPCGPCSEIHYDRTGNRDAASLVNNDDPTCIEIWNIVFIQFNRESDGSLKPLPAKHVDTGLGFERLTSILQNKMSNYDTDVFMPIFDAIQQATGARPYSGKVGADDADKVDMAYRVVADHIRTLSFAIADGSCPGNEGREYVLRRILRRAVRYGSEVLKAQDGFFNGLVNIVVKVMGDVFPELKQREAHIREIIAAEEASFGKTLLKGIEKFKKAAQDVQGKVLSGQDAFILWDTYGFPLDLTQLMAEERGLLVDIEGFNNAMDEARERSRSAQNKQAGGAIVMDADATAALHKRGVLATDDSFKFIWFQDHKSVIKAIYTGSEFIESVVPGNEVGIVLASSSFYAEQGGQIFDEGFIEGLFGSFYVRNVQIYGGFVIHIGSLTEGAGRFSVGEEVICKVDYDRRKLIAPNHTCTHMLNFALREVLGDHVDQKGSVVLPEKLRFDFSHGKPVDPEHLRRIESIVNEQIKAELDVFSKEATLAEAKCINGLRAVFGEVYPDPVRVVAIGRKVEDLLADPENKEWLSISAELCGGTHLSNTREAEAFALLSEEGIAKGIRRITAVTTGLAYKAFEAACSLEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAEENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDETTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMDLAAEFAAMKLR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccEEEcccccccccccccccccEEEEEEHHHHcccccccccccccccccccccccHHHHHHHHHcccccccHHcHHHHHHHHHHHHccccccccccccccccccccEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccCEEcHHHHHHHHHcccccccccccCECccccEEEEEEEEEccCEEEEEccccEEEEEEcccccccccccccccEEEEEEccEEEEEEcEEEEccEEEEEEEEEccccccccccEEEEEEcHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHcccEEcccccccccEEEEEEccccccccccccccccccccEEEccccccccccccccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEccccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcc
MNQYKPIFLGTADPNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELLTKVYRLPADRLYATYFGGDEKAGLAPDNEARDIWLKFLPASRVLPFGCKDNFWEMGDTGPCGPCSEIHYDRTGNRDAASLVNNDDPTCIEIWNIVFIQFNRESDGSLKPLPAKHVDTGLGFERLTSILQNKMSNYDTDVFMPIFDAIQQATGARPYSGKVGADDADKVDMAYRVVADHIRTLSFAIADGSCPGNEGREYVLRRILRRAVRYGSEVLKAQDGFFNGLVNIVVKVMGDVFPELKQREAHIREIIAAEEASFGKTLLKGIEKFKKAAQDVQGKVLSGQDAFILWDTYGFPLDLTQLMAEERGLLVDIEGFNN*******************AIVMDADATAALHKRGVLATDDSFKFIWFQDHKSVIKAIYTGSEFIESVVPGNEVGIVLASSSFYAEQGGQIFDEGFIEGLFGSFYVRNVQIYGGFVIHIGSLTEGAGRFSVGEEVICKVDYDRRKLIAPNHTCTHMLNFALREVLGDHVDQKGSVVLPEKLRFDFSHGKPVDPEHLRRIESIVNEQIKAELDVFSKEATLAEAKCINGLRAVFGEVYPDPVRVVAIGRKVEDLLADPENKEWLSISAELCGGTHLSNTREAEAFALLSEEGIAKGIRRITAVTTGLAYKAFEAACSLEKEVDDASKI*GSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALL******************************ASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDETTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCG**KGG******TDAAQVTPAMDLAAEFAAMKLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQYKPIFLGTADPNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELLTKVYRLPADRLYATYFGGDEKAGLAPDNEARDIWLKFLPASRVLPFGCKDNFWEMGDTGPCGPCSEIHYDRTGNRDAASLVNNDDPTCIEIWNIVFIQFNRESDGSLKPLPAKHVDTGLGFERLTSILQNKMSNYDTDVFMPIFDAIQQATGARPYSGKVGADDADKVDMAYRVVADHIRTLSFAIADGSCPGNEGREYVLRRILRRAVRYGSEVLKAQDGFFNGLVNIVVKVMGDVFPELKQREAHIREIIAAEEASFGKTLLKGIEKFKKAAQDVQGKVLSGQDAFILWDTYGFPLDLTQLMAEERGLLVDxxxxxxxxxxxxxxxxxxxxxQAGGAIVMDADATAALHKRGVLATDDSFKFIWFQDHKSVIKAIYTGSEFIESVVPGNEVGIVLASSSFYAEQGGQIFDEGFIEGLFGSFYVRNVQIYGGFVIHIGSLTEGAGRFSVGEEVICKVDYDRRKLIAPNHTCTHMLNFALREVLGDHVDQKGSVVLPEKLRFDFSHGKPVDPEHLRRIESIVxxxxxxxxxxxxxxxxxxxxxCINGLRAVFGEVYPDPVRVVAIGRKVEDLLADPENKEWLSISAELCGGTHLSNTREAEAFALLSEEGIAKGIRRITAVTTGLAYKAFEAACSLEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDETTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAMDLAAEFAAMKLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alanine--tRNA ligase Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.confidentP36428
Alanine--tRNA ligase, cytoplasmic Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.probableQ54Y20
Alanine--tRNA ligase, mitochondrial Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.probableP40825

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.7Alanine--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZTG, chain A
Confidence level:very confident
Coverage over the Query: 1-90,126-424,440-643,661-699
View the alignment between query and template
View the model in PyMOL
Template: 1YFS, chain A
Confidence level:very confident
Coverage over the Query: 1-408
View the alignment between query and template
View the model in PyMOL
Template: 2ZZF, chain A
Confidence level:confident
Coverage over the Query: 36-89,126-146,164-405,418-440,458-695
View the alignment between query and template
View the model in PyMOL
Template: 2ZVF, chain A
Confidence level:probable
Coverage over the Query: 726-740,751-903
View the alignment between query and template
View the model in PyMOL