Citrus Sinensis ID: 002709


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890
MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHRASLEQRRSKVTQEVQAEDIEKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAKIQAQQQQNVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDSVVNDGVQEGKINKKHKANKKQKHNPASDEAEVSLRDNGEGKTKGPKRNRKDRPDRQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDKSMKRKRPKKNKDTAGREAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS
cccccccccccCEEEEEcccHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccEEEEccccHHHHHccccccccccccccHHHcccHHHHHHHHHHHHHccccccccEEcccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHcccccccccHHHHHHHHcccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccEEEccEEEEEEEccccHHHHHHHHHccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccc
********EHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVK***************************************KHSSKLLESGKTV*PRKAATLGI**********KQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKG**********************************NADFDEEVDIARKVLNK*T****SLPSLSDDSA*********************************************QNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKK*******************LYLAKEGLIL********************************FHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKK******HYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQ*****************************************************************************************************************************************************************************DVLIE******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHxxxxxxxxxxxxxxxxxxxxxKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIxxxxxxxxxxxxxxxxxxxxxQQQNVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDSVVNDGVQEGKINKKHKANKKQKHNPASDEAEVSLRDNGEGKTKGPKRNRKDRPDRQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDKSMKRKRPKKNKDTAGREAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMR, chain A
Confidence level:confident
Coverage over the Query: 121-293
View the alignment between query and template
View the model in PyMOL
Template: 1X4H, chain A
Confidence level:confident
Coverage over the Query: 412-522
View the alignment between query and template
View the model in PyMOL
Template: 1P1T, chain A
Confidence level:confident
Coverage over the Query: 223-296
View the alignment between query and template
View the model in PyMOL
Template: 1FXL, chain A
Confidence level:probable
Coverage over the Query: 123-293
View the alignment between query and template
View the model in PyMOL
Template: 2KN4, chain A
Confidence level:probable
Coverage over the Query: 211-296
View the alignment between query and template
View the model in PyMOL
Template: 4F02, chain A
Confidence level:probable
Coverage over the Query: 177-302
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:probable
Coverage over the Query: 219-310
View the alignment between query and template
View the model in PyMOL
Template: 3SMZ, chain A
Confidence level:probable
Coverage over the Query: 170-297
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:probable
Coverage over the Query: 219-310
View the alignment between query and template
View the model in PyMOL
Template: 3SDE, chain A
Confidence level:probable
Coverage over the Query: 209-299
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:probable
Coverage over the Query: 219-310
View the alignment between query and template
View the model in PyMOL