Citrus Sinensis ID: 002709


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890
MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHRASLEQRRSKVTQEVQAEDIEKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAKIQAQQQQNVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDSVVNDGVQEGKINKKHKANKKQKHNPASDEAEVSLRDNGEGKTKGPKRNRKDRPDRQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDKSMKRKRPKKNKDTAGREAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS
cccccccccccEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccEEEEccccHHHHHHcccccccccccccHHHcccHHHHHHHHHHHHHccccccccEEcccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHcccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccEEEccEEEEEEEccccHHHHHHHHHHccccHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccc
ccccccccccccEEEEEEccHHHHHHHHHHHcccEEccEEEEEEEEcccccHHHHHHHHcHHHHcccccccccccccccccHHccccccHHcccccccccccccccccccHccHHHHHHHccEEEEccccccccHHHHHHHHHHcccEEEEEccccHHHHHccccccccccccEEEEEEccHHHHHHHHHHHcccHccccEEEEEEcccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHccccccccEEEccEEEEEEEcccHHHHHHHHHHcccccccccccEEEEccccEccccHHHccccHHHHHHHHHHHHHHHHHHcccccEEcccEEEEEcccccccHHHHHHHHHHHHHcccccccccEEEEEEEEEccccccccccccccEEEEEEccHHHHHHHHHHHHccccHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHcHHcccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccc
mvtkkgsnehrgfgyvQFAVMEDANRavemkngtsvggrkiGVKHAMHRASLEQRRSKVTQEVQAEDIEktmdnkdgvisgaeKHSSKLlesgktvkprkaatlgidladkedcsqKQRVARTVIIGGLLNADMAEEVHRLAGSIgtvcsvtyplpkeeleqhglaqegckmDASAVLYTTVKSACASVALLHQKEIKGGTVWArqlggegsktqKWKLIIRNIPFKAKVNEIKdmfspvglvwnvyiphntdtglskgFAFVKFTCKRDAESAIQKfngqkfgkrpiavdwavpkniyssggaaagayedgvqnkgdgnsdsgsdddlgdddaetasddsnssekedlpsnadfdeEVDIARKVLNKLTsttgslpslsddsalvkgnkeqdsdktvnesakvsdvsklnsskskpkslkqtegedelQNTIFIcnlpfdldnEEVKQRFSAFgevvsfvpvlhqvtkrpkgtgflkFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLahdkeidksknetndhrnLYLAkeglilegtpaaegvsdddmsKRQMLHEkkmtklqspnfhvsRTRLVIynlpksmtekGLKKLCIDAVVSRASKQKPVIKQIKFLQSlkkgkvdtkhysrgvafVEFTEHQHALVALRVlnnnpktfgpehrpIVEFAVDNVQTLKQRNAKIQAQQQQnvesntmdtypnkleksrkrkpigdsrsekdsghgedsvvndgvqegkinkkhkankkqkhnpasdeaevslrdngegktkgpkrnrkdrpdrqkpdvetstkgndarksnsseQAHFRSQkrklgyqteglvgdksmkrkrpkknkdtagrEAVDKLDVLIEKYRTKfsqqgsnkpdggrqgskqLRRWFQS
mvtkkgsnehrgfgyvQFAVMEDANRAVEMkngtsvggrkigVKHAMHrasleqrrskvtqevqaediektmdnkdgvisgaekhsskllesgktvkprkaatlgidladkedcsqkqRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWarqlggegsktqkwkLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAiqkfngqkfgkrpiavDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAEtasddsnssekedlpsnadfdEEVDIARKVLNKltsttgslpslsddsalvkgnkeqdsdktvnesakvsdvsklnsskskpkslkqtegedelqNTIFICNLPFDLDNEEVKQRFSAFGEVVsfvpvlhqvtkrpkgtgflKFKTVEAATAAvsaskttsglgiflkgrQLTVLKALDKKlahdkeidksknetndhrnlYLAKeglilegtpaaegvsdddMSKRQMLHEkkmtklqspnfhvsrTRLVIynlpksmtekGLKKLCIDAVVsraskqkpvikqikflqslkkgkvdtKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAKIqaqqqqnvesntmdtypnkleksrkrkpigdsrsekdsghgedsvvndgvqegkinkkhkankkqkhnpasdeaevslrdngegktkgpkrnrkdrpdrqkpdvetstkgndarksnsseqahfrsqkrklgyqteglvgdksmkrkrpkknkdtagreavdkLDVLIEKYRtkfsqqgsnkpdggrqgskqlrrwfqs
MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHRASLEQRRSKVTQEVQAEDIEKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSggaaagaYEDGVQNKgdgnsdsgsdddlgdddaetasddsnsseKEDLPSNADFDEEVDIARKVLNKltsttgslpslsddsALVKGNKEQDSDKTVNESAKVSDVsklnsskskpkslkQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFktveaataavsaskttsGLGIFLKGRQLTVlkaldkklahdkEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLkqrnakiqaqqqqnVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDSVVNDGVQEGkinkkhkankkqkhnPASDEAEVSLRDNGEGKTKGPKRNRKDRPDRQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDksmkrkrpkknkDTAGREAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS
***********GFGYVQFAVMED*********************************************************************************************KQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGG******************************************************************************************************************************QNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKK*******************LYLAKEGLIL********************************FHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQ*****************************************************************************************************************************************************************************DVLIE******************************
MVT****NEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVK***************************************KHSSKLLESGKTV*PRKAATLGI*************VARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYP******************DASAVLYTTVKSACASVALLHQKEI**********************IIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYS*GGAAAGAYEDGVQNKGDGNSDSG****LGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNK*T****SLPSLSDDSALVK*********************************************IFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKA**********************************************************************TRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIK******************VAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNV**********************************************************************************************************************************************************************************************************LRRWFQ*
********EHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMH*************EVQAEDIEKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKG**********************************NADFDEEVDIARKVLNKLTSTTGSLPSLSDDSA******************************************DELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQR*************SNTMDTYPNKL************************VVNDGVQEGKINK************************************************************************KLGYQTEGLVG*****************REAVDKLDVLIEKYRTK*************************
********EHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHRA***************************************************************CSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGA****************************************************************************************************************************LQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEI****NETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKK******HYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAKIQAQQ***********************************************************************************************************************************************************AVDKLDVLIEKYRTKFS***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHxxxxxxxxxxxxxxxxxxxxxKTMDNKDGVISGAEKHSSKLLESGKTVKPRKAATLGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIxxxxxxxxxxxxxxxxxxxxxQQQNVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDSVVNDGVQEGKINKKHKANKKQKHNPASDEAEVSLRDNGEGKTKGPKRNRKDRPDRQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDKSMKRKRPKKNKDTAGREAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query890 2.2.26 [Sep-21-2011]
Q8CGC6750 RNA-binding protein 28 OS yes no 0.541 0.642 0.345 4e-57
Q9NW13759 RNA-binding protein 28 OS no no 0.287 0.337 0.448 6e-46
O74400674 Uncharacterized RNA-bindi yes no 0.487 0.643 0.264 3e-29
P37838685 Nucleolar protein 4 OS=Sa yes no 0.304 0.395 0.288 2e-26
P70372326 ELAV-like protein 1 OS=Mu no no 0.196 0.536 0.296 3e-09
Q15717326 ELAV-like protein 1 OS=Ho no no 0.196 0.536 0.291 3e-08
Q9Y4C8960 Probable RNA-binding prot no no 0.084 0.078 0.379 9e-08
Q8R3C6952 Probable RNA-binding prot no no 0.084 0.078 0.379 1e-07
Q19706256 Eukaryotic translation in no no 0.086 0.300 0.350 2e-07
A8WLV5261 Eukaryotic translation in N/A no 0.086 0.295 0.350 2e-07
>sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 267/503 (53%), Gaps = 21/503 (4%)

Query: 218 KLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQK 277
           +LIIRN+ FK   +++K +F+  G V  V IP   D G  +GFAFV+F    +A  A++ 
Sbjct: 115 RLIIRNLSFKCSEDDLKAVFTHYGTVLEVNIPKKPD-GKMRGFAFVQFKNLLEAGKALKG 173

Query: 278 FNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNS-DSGSDD-DLGDDDAE 335
            N ++   R +AVDWAV K+ Y     A+     GV+   D    +SG  +  + +   +
Sbjct: 174 ANMKEIKGRTVAVDWAVAKDKYKDAQHASAP---GVKKSSDRKPKESGKKNCRVEEQVED 230

Query: 336 TASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLS-DDSALVKGNKEQDS 394
           +  ++ + S  ++    +     V + ++ + +           S +DS L +G    D 
Sbjct: 231 SDDEEDDDSHDDEEERESTIASPVSVHKRAVKRAAPEESIEEDDSYEDSDLEEGGSSYDE 290

Query: 395 DKTVNES-AKVSDVSKLNSSKSKPKSLKQ--TEGEDELQNTIFICNLPFDLDNEEVKQRF 451
               +ES A+  +   +  S+ K + L    TEG+     T+FI NL FD + E + +  
Sbjct: 291 GTVDSESSAEDQEDEDVPVSEKKKRKLPSDVTEGK-----TVFIRNLSFDSEEEALGEVL 345

Query: 452 SAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSA-SKTTSGLGIFLKGRQLTVL 510
             FG++     VLH  T+  KG  F +F T EAA   ++A S    G G+ L GRQL V 
Sbjct: 346 QQFGDLKYVRVVLHPDTEHSKGCAFAQFMTQEAAQKCLAAASLEAEGGGLKLDGRQLKVD 405

Query: 511 KALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKM 570
            A+ +  A   +  K K  T   RNLYLA+EGLI  GT AAEGVS  DM+KR+     K 
Sbjct: 406 LAVTRDEAAKLQTKKVKKPTGT-RNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKH 464

Query: 571 TKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKG 630
            KL++ N  VS+TRL ++NLPK++ +K L+KL ++A       +   IK+ + ++ LK  
Sbjct: 465 QKLKNQNIFVSQTRLCLHNLPKAVDDKQLRKLLLEATRGEKGVR---IKECRVMRDLKGV 521

Query: 631 KVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAK 690
               K  S G AF EF +H+HAL ALR  NNNP+ FG + RPIVEF++++ + LK +  +
Sbjct: 522 HGKMKGQSLGYAFAEFQKHEHALRALRHFNNNPEIFGSQKRPIVEFSLEDRRKLKVKELR 581

Query: 691 IQAQQQQNVESNTMDTYPNKLEK 713
           IQ +  Q +ES  + + P K +K
Sbjct: 582 IQ-RSLQKMESKPVTSKPQKEQK 603




Nucleolar component of the spliceosomal ribonucleoprotein complexes.
Mus musculus (taxid: 10090)
>sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 Back     alignment and function description
>sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 Back     alignment and function description
>sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 Back     alignment and function description
>sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 Back     alignment and function description
>sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 Back     alignment and function description
>sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 Back     alignment and function description
>sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=1 Back     alignment and function description
>sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query890
224105333974 predicted protein [Populus trichocarpa] 0.982 0.897 0.603 0.0
225427688972 PREDICTED: uncharacterized protein LOC10 0.988 0.905 0.607 0.0
297744765918 unnamed protein product [Vitis vinifera] 0.958 0.929 0.609 0.0
356546384956 PREDICTED: RNA-binding protein 28-like [ 0.986 0.918 0.594 0.0
356542361958 PREDICTED: RNA-binding protein 28-like [ 0.979 0.910 0.582 0.0
449461647966 PREDICTED: RNA-binding protein 28-like [ 0.970 0.894 0.561 0.0
357441411962 Eukaryotic translation initiation factor 0.969 0.897 0.559 0.0
255543791916 RNA-binding protein, putative [Ricinus c 0.929 0.902 0.561 0.0
297824993988 RNA recognition motif-containing protein 0.959 0.864 0.503 0.0
18399701 1003 RNA recognition motif-containing protein 0.956 0.848 0.489 0.0
>gi|224105333|ref|XP_002313773.1| predicted protein [Populus trichocarpa] gi|222850181|gb|EEE87728.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/941 (60%), Positives = 683/941 (72%), Gaps = 67/941 (7%)

Query: 1   MVTKKGSNEHRGFGYVQFAVMEDANRAVEMKNGTSVGGRKIGVKHAMHRASLEQRRSKVT 60
           MVT+KGS EHRGFG+VQFA+ +DANRA+E+KNG+SVGGRKI VKHAMHRASLEQRR+K  
Sbjct: 50  MVTQKGSTEHRGFGFVQFALKDDANRAIEIKNGSSVGGRKIAVKHAMHRASLEQRRAKAA 109

Query: 61  Q---EVQAEDIEKTMDNKDGVISGAEKHSSKLLESG------------KTVKPRKAATLG 105
           Q   +VQ +D  KT+D K  V S  EKH   +LESG            K  +PRK A L 
Sbjct: 110 QGQGQVQ-DDATKTIDEKGSVASKPEKHVLNVLESGWELWYILSCMLRKPREPRKPAKLV 168

Query: 106 IDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGL 165
            DL DKE+CS+KQRVARTVI GGLLN  MAE+VH+ A   GTVCSVTYPLPKEEL++HGL
Sbjct: 169 TDLTDKENCSEKQRVARTVIFGGLLNDAMAEDVHQRAKETGTVCSVTYPLPKEELKKHGL 228

Query: 166 AQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIP 225
            Q+GC+  ASAVL+T+VK A +SVA+LHQKEIKGG VWARQLGGEG KTQKWKLIIRN+P
Sbjct: 229 EQDGCRSGASAVLFTSVKEARSSVAMLHQKEIKGGIVWARQLGGEGCKTQKWKLIIRNLP 288

Query: 226 FKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGK 285
           FKAK NEIK +F   G VW+V++PHN++TGLSKGFAFVKFTCK+DAE+AIQKFNGQKFGK
Sbjct: 289 FKAKPNEIKGVFESAGCVWDVFVPHNSETGLSKGFAFVKFTCKQDAENAIQKFNGQKFGK 348

Query: 286 RPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDD-------------LG-- 330
           RPIAVDWAVPK IYSSG   + A EDG  + G  N    S +D             +G  
Sbjct: 349 RPIAVDWAVPKKIYSSGANVSAASEDGNASAGHQNEKDSSCEDSDYDDEDDNDTDVIGKK 408

Query: 331 --DDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKG 388
              D     S DS+ SEKED+P+  DF++E DIARKVL  L +++  +        L KG
Sbjct: 409 QQHDGVVVTSPDSDLSEKEDMPTEVDFEQEADIARKVLRNLIASSSDV--------LPKG 460

Query: 389 NKEQDS----DKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDN 444
            +E ++     K   ES  +S  S L+S KSKP + K  +GED+LQ T+FI NLPFD+++
Sbjct: 461 IEELETVDVPSKLPGESENLSG-SPLSSGKSKPSNTKHIDGEDDLQRTVFISNLPFDVES 519

Query: 445 EEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKG 504
            EVKQRFSAFGEV+SFVPVLHQVTKRP+GTGFLKFKT + ATAAVSA+   SGLGIFLKG
Sbjct: 520 GEVKQRFSAFGEVLSFVPVLHQVTKRPRGTGFLKFKTADGATAAVSAANVASGLGIFLKG 579

Query: 505 RQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQM 564
           RQLTV KALDKK AHDKE +K+K E  DHRNLYLAKEGLILEGTPAAEGVS  DM+KR  
Sbjct: 580 RQLTVFKALDKKSAHDKEKEKTKIEDRDHRNLYLAKEGLILEGTPAAEGVSISDMAKRNR 639

Query: 565 LHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFL 624
           L E+KMTKL+SPNFHVSRTRLV+YNLPKSMTEK LKKL IDAV SRA+KQKPVI+Q+KFL
Sbjct: 640 LQEEKMTKLRSPNFHVSRTRLVVYNLPKSMTEKQLKKLFIDAVTSRATKQKPVIRQMKFL 699

Query: 625 QSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTL 684
           +++KKGKV TK +SRGVAFVEFTEHQHALVALRVLNNNP+TFGPEHRPIV FA+DNVQTL
Sbjct: 700 KNVKKGKVVTKDHSRGVAFVEFTEHQHALVALRVLNNNPETFGPEHRPIVSFALDNVQTL 759

Query: 685 KQRNAKIQAQQ----------QQNVESNTMDTYPNKLEKSRKRKPIGDSRSEKD-SGHGE 733
           K R AK+Q QQ          Q+N ES T +  P++ E SRKRK   ++R+ KD   +  
Sbjct: 760 KLRKAKLQVQQQETHKDFQDTQENDESQTPNAIPSQKEMSRKRKSRVENRAVKDPESNRM 819

Query: 734 DSVVNDGVQEGKINKKHKANKKQKHNPASDEAEVSLRDNGEG---KTKGPKRNRKDRPDR 790
           D V N       +  K +  KK+K NP +++ + S +D  E    K KG +  +KD  + 
Sbjct: 820 DEVKNKDSYRTSL--KEQTAKKKKSNPGAEDIQTSAKDKRESREQKAKGSQHKQKD--EG 875

Query: 791 QKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDKSM-KRKRPKKNKDTAGR 849
           +K D   S   N  +     ++A     KRK   QTE   G KS  KRKRPKKNKD  G+
Sbjct: 876 RKSDGGNSV--NSEKIVKPFKEADLWLTKRKRPNQTEENKGGKSSEKRKRPKKNKDPVGQ 933

Query: 850 EAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS 890
           +  DKLD+LIE+Y++KFS+Q ++KP+G +Q +KQL+RWFQS
Sbjct: 934 DVADKLDMLIEQYKSKFSKQTADKPEGEKQANKQLKRWFQS 974




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225427688|ref|XP_002274081.1| PREDICTED: uncharacterized protein LOC100257200 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744765|emb|CBI38027.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546384|ref|XP_003541606.1| PREDICTED: RNA-binding protein 28-like [Glycine max] Back     alignment and taxonomy information
>gi|356542361|ref|XP_003539635.1| PREDICTED: RNA-binding protein 28-like [Glycine max] Back     alignment and taxonomy information
>gi|449461647|ref|XP_004148553.1| PREDICTED: RNA-binding protein 28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357441411|ref|XP_003590983.1| Eukaryotic translation initiation factor 3 subunit G [Medicago truncatula] gi|355480031|gb|AES61234.1| Eukaryotic translation initiation factor 3 subunit G [Medicago truncatula] Back     alignment and taxonomy information
>gi|255543791|ref|XP_002512958.1| RNA-binding protein, putative [Ricinus communis] gi|223547969|gb|EEF49461.1| RNA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297824993|ref|XP_002880379.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297326218|gb|EFH56638.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18399701|ref|NP_565513.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|4567275|gb|AAD23688.1| expressed protein [Arabidopsis thaliana] gi|16604631|gb|AAL24108.1| unknown protein [Arabidopsis thaliana] gi|27754736|gb|AAO22811.1| unknown protein [Arabidopsis thaliana] gi|330252084|gb|AEC07178.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query890
TAIR|locus:20500241003 AT2G21440 [Arabidopsis thalian 0.920 0.816 0.457 7.2e-202
UNIPROTKB|Q9NW13759 RBM28 "RNA-binding protein 28" 0.516 0.606 0.320 5.4e-54
UNIPROTKB|E1BLD4756 RBM28 "Uncharacterized protein 0.425 0.501 0.327 2.6e-51
RGD|1311336749 Rbm28 "RNA binding motif prote 0.423 0.503 0.338 5.6e-51
UNIPROTKB|E2RIB8751 RBM28 "Uncharacterized protein 0.277 0.328 0.417 6.7e-50
MGI|MGI:2655711750 Rbm28 "RNA binding motif prote 0.420 0.498 0.321 1e-48
ZFIN|ZDB-GENE-040426-960865 rbm28 "RNA binding motif prote 0.277 0.285 0.384 1.4e-48
UNIPROTKB|G3MZL2610 RBM28 "Uncharacterized protein 0.425 0.621 0.327 7.8e-41
WB|WBGene00011043608 rbm-28 [Caenorhabditis elegans 0.273 0.399 0.325 3.2e-40
FB|FBgn0260456657 CG4806 [Drosophila melanogaste 0.301 0.407 0.321 3e-37
TAIR|locus:2050024 AT2G21440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1745 (619.3 bits), Expect = 7.2e-202, Sum P(2) = 7.2e-202
 Identities = 403/881 (45%), Positives = 513/881 (58%)

Query:    43 VKHAMHRASLEQ--RRSKVTQEVQAEDIEKTMDNKDGVISGAEKHSSKLLESGKTVKP-- 98
             V+  + R  +E+   R K  + ++ + +EK  + K        K   K +E  +  KP  
Sbjct:   152 VEKPIERKQVEKPVERKKAEKPIELKQVEKPFERKQVEKPVERKQVEKPVERKQVEKPIE 211

Query:    99 RKAAT-LGIDLADKEDCSQKQRVARTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPK 157
             RK  T L +DL DKE CS KQRVARTVI GGL NA+MAE VH     IGTVCSV YPLPK
Sbjct:   212 RKRPTKLHVDLPDKETCSDKQRVARTVIFGGLANAEMAEVVHSRVKEIGTVCSVRYPLPK 271

Query:   158 EELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKW 217
             EEL+Q+GL Q+GC+ +ASAVL+T+VKSACA+VA LHQ E+KG  +WARQLGGEGSK QKW
Sbjct:   272 EELQQNGLTQDGCRAEASAVLFTSVKSACAAVAKLHQTEVKGNLIWARQLGGEGSKAQKW 331

Query:   218 KLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQK 277
             KLIIRN+PF+AK ++IK +FS VG VW+V+IP N +TGL KGFAFVKFTCK+DA +AI+K
Sbjct:   332 KLIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDAANAIKK 391

Query:   278 FNGQKFGKRPIAVDWAVPKNIYSSXXXXXXXYEDG--------VQNKXXXXXXXXXXXXX 329
             FNG  FGKRPIAVDWAVPKNIY+          DG         +N              
Sbjct:   392 FNGHMFGKRPIAVDWAVPKNIYNGAADATTASADGDKEGSDGDSENSSVDLEEVDEAVES 451

Query:   330 XXXXXXXXXXXXXXXXK--------EDLPSNADFDEEVDIARKVLNKXXXXXXXXXXXXX 381
                             K        +D+ ++ +F++E D+ARKVL               
Sbjct:   452 HPPPGDDTDDDEDGSNKLTESDALDKDVGTDMNFEDEADVARKVLKNLLASSKGST---- 507

Query:   382 XXALVKGNKEQ-DSDKTVNESAK-VSDVXXXX----XXXXXXXXXXQTEGEDELQNTIFI 435
               A  +G  E+ D  K  + S K V+D                   +T+  D+ + T+FI
Sbjct:   508 --ATPEGETEESDKSKLKSSSTKPVADSSGVSEPLKSGKTKVVAPKETQDNDDFERTLFI 565

Query:   436 CNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFXXXXXXXXXXXXXXXX 495
              NLPFD+  EEVKQRF+ FGEV S   VLH+VTKRP+GT F+KF                
Sbjct:   566 RNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAADTA 625

Query:   496 XGLGIFLKGRQLTVXXXXXXXXXXXXEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVS 555
              G+G+ LKGRQL V            E+ K++ +  DHRNLYLAKEG IL+ TPAAEGVS
Sbjct:   626 SGVGVLLKGRQLNVMRAVGKKAAKDIELKKTEEKNVDHRNLYLAKEGQILDDTPAAEGVS 685

Query:   556 DDDMSKRQMLHEKKMTKLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQK 615
              +DM KR+ LHE KM  LQSPNFHVSRTRLVIYNLPKSM  K L +L +DAV SRA+KQK
Sbjct:   686 AEDMDKRRRLHENKMKMLQSPNFHVSRTRLVIYNLPKSMNPKQLNRLLVDAVTSRATKQK 745

Query:   616 PVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQHALVALRVLNNNPKTFGPEHRPIVE 675
             P I+QIKFLQ+ KKGKVDTK+YSRGVAFVEFTEH+HALVALRVLNNNP+TFGP+HRP++E
Sbjct:   746 PCIRQIKFLQNEKKGKVDTKNYSRGVAFVEFTEHEHALVALRVLNNNPETFGPQHRPVIE 805

Query:   676 FAVDNVQTLXXXXXXXXXXXXXXVESNTMDTYPNKLEKSRKRKPIGDSRSEKDSGHGEDS 735
             FAVDNVQ L               + N  D    +      + P  D++ ++ +  G+  
Sbjct:   806 FAVDNVQKLKIREAKQQQFQQRE-KHNESD---QQQANGEAQAP--DNKYKRKTREGD-- 857

Query:   736 VVNDGVQEGXXXXXXXXXXXXXXXPASDEAEVSLRDNGEGKTKG------PKRNRKDRPD 789
               N G ++                 A  ++ ++++DN   K +       P  N+K +  
Sbjct:   858 --NTGPRKENAARFKKGPREESKEEA--KSNIAVKDNAAEKKRPIRTQEKPSSNKKGQLM 913

Query:   790 RQKPDVETSTKGNDARKSNSSEQAHFRSQKRKLGYQTEGLVGDXXXXXXXXXXXXDTAGR 849
             RQK   ET+ K +     + SE      +KRK G +  G   +               G 
Sbjct:   914 RQK---ETTEKPDPKISKDLSEP-----RKRKFG-EDRG-EENRNGQRKRKKQGQGQGGA 963

Query:   850 EAVDKLDVLIEKYRTKFSQQGSNKPDGGRQGSKQLRRWFQS 890
             E VDKLD+LIEKYR+KFSQ  S K    +Q S Q+RRWF+S
Sbjct:   964 EVVDKLDLLIEKYRSKFSQS-SAKTGPQKQSSGQVRRWFES 1003


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
UNIPROTKB|Q9NW13 RBM28 "RNA-binding protein 28" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLD4 RBM28 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311336 Rbm28 "RNA binding motif protein 28" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIB8 RBM28 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2655711 Rbm28 "RNA binding motif protein 28" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-960 rbm28 "RNA binding motif protein 28" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZL2 RBM28 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00011043 rbm-28 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0260456 CG4806 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query890
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 2e-45
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-27
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-23
smart0036073 smart00360, RRM, RNA recognition motif 9e-20
smart0036073 smart00360, RRM, RNA recognition motif 1e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-15
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-15
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-15
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-14
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-14
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 3e-14
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-14
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 7e-14
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 2e-13
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-13
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 7e-13
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-12
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 4e-12
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-12
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 9e-12
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 1e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-11
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-11
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 4e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 3e-10
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-10
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 4e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 6e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 7e-10
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 9e-10
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-09
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 1e-09
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-09
cd12677156 cd12677, RRM4_Nop4p, RNA recognition motif 4 in ye 1e-09
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-09
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 4e-09
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-09
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 4e-09
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 5e-09
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 5e-09
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 5e-09
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 5e-09
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-09
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-08
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 1e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-08
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-08
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-08
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-08
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-08
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 3e-08
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-08
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-08
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 5e-08
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 6e-08
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-08
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 8e-08
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 9e-08
smart0036073 smart00360, RRM, RNA recognition motif 1e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-07
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-07
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-07
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-07
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 4e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-07
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 5e-07
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 5e-07
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 5e-07
cd1227786 cd12277, RRM3_MEI2_EAR1_like, RNA recognition moti 5e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-07
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 7e-07
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 7e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-07
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 8e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 9e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 1e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-06
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 1e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 1e-06
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-06
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 2e-06
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-06
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 2e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-06
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 2e-06
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-06
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 3e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-06
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 3e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 3e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 3e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 3e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 3e-06
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 4e-06
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-06
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 5e-06
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 5e-06
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 5e-06
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 5e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 6e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 6e-06
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 6e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 6e-06
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 6e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 6e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-06
smart0036073 smart00360, RRM, RNA recognition motif 7e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 7e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 7e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 8e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 8e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 9e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 1e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-05
cd1251575 cd12515, RRM5_RBM12_like, RNA recognition motif 5 1e-05
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 1e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-05
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 1e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 1e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-05
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-05
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-05
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 2e-05
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 2e-05
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-05
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-05
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-05
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 3e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 3e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 3e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 4e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 4e-05
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 4e-05
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 5e-05
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 5e-05
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 5e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 5e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 5e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 5e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 6e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 7e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 7e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-05
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 8e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 8e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 8e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 9e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 9e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 9e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 9e-05
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 9e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 9e-05
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-04
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-04
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 2e-04
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 2e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 2e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-04
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 2e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-04
cd1243979 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA 2e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 2e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-04
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-04
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 3e-04
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 3e-04
cd1275077 cd12750, RRM5_RBM12B, RNA recognition motif 5 in R 3e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 3e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 3e-04
cd1256972 cd12569, RRM4_RBM19, RNA recognition motif 4 in RN 3e-04
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 3e-04
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 3e-04
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 3e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 3e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 4e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 4e-04
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 4e-04
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 4e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 5e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 5e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 5e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 5e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 5e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 5e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 6e-04
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 6e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-04
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 6e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 6e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 6e-04
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 6e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 6e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 7e-04
cd1250477 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 7e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 7e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 7e-04
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 7e-04
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 7e-04
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 8e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 9e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-04
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 9e-04
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 9e-04
cd1233179 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif 9e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.001
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 0.001
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.001
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.001
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.001
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.001
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 0.001
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.001
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.001
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 0.001
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.001
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.002
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.002
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.002
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.002
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 0.002
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.002
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 0.002
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 0.002
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.002
cd1249285 cd12492, RRM2_RBM46, RNA recognition motif 2 found 0.002
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.002
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 0.002
cd1250675 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m 0.002
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 0.002
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 0.002
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 0.002
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 0.002
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 0.003
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 0.003
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.003
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.003
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 0.003
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.003
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.003
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 0.003
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.003
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.003
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.003
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 0.004
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 0.004
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 0.004
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 0.004
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.004
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.004
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.004
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.004
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 0.004
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 0.004
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 0.004
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
 Score =  157 bits (400), Expect = 2e-45
 Identities = 58/98 (59%), Positives = 73/98 (74%)

Query: 583 TRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVA 642
           TRL I NLPKS+ EK LK+L + AV  RA K+KP IKQ+K ++ LK+   + K  S+G  
Sbjct: 1   TRLSIRNLPKSVDEKKLKELFLKAVSERAGKKKPKIKQVKIMRDLKRVDPNGKGKSKGYG 60

Query: 643 FVEFTEHQHALVALRVLNNNPKTFGPEHRPIVEFAVDN 680
           FVEFT H+HAL ALR LNNNP+ FGP+ RPIVEFA++N
Sbjct: 61  FVEFTNHEHALKALRALNNNPEIFGPDKRPIVEFAIEN 98


This subfamily corresponds to the RRM4 of RBM28 and Nop4p. RBM28 is a specific nucleolar component of the spliceosomal small nuclear ribonucleoproteins (snRNPs), possibly coordinating their transition through the nucleolus. It specifically associates with U1, U2, U4, U5, and U6 small nuclear RNAs (snRNAs), and may play a role in the maturation of both small nuclear and ribosomal RNAs. RBM28 has four RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and an extremely acidic region between RRM2 and RRM3. The family also includes nucleolar protein 4 (Nop4p or Nop77p) encoded by YPL043W from Saccharomyces cerevisiae. It is an essential nucleolar protein involved in processing and maturation of 27S pre-rRNA and biogenesis of 60S ribosomal subunits. Nop4p also contains four RRMs. . Length = 98

>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241121 cd12677, RRM4_Nop4p, RNA recognition motif 4 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240723 cd12277, RRM3_MEI2_EAR1_like, RNA recognition motif 3 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240959 cd12515, RRM5_RBM12_like, RNA recognition motif 5 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA (uracil-5-)-methyltransferase homolog A (TRMT2A) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241194 cd12750, RRM5_RBM12B, RNA recognition motif 5 in RNA-binding protein 12B (RBM12B) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241013 cd12569, RRM4_RBM19, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240936 cd12492, RRM2_RBM46, RNA recognition motif 2 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 890
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 100.0
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.98
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.97
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.97
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.97
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.97
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.95
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.94
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.94
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.92
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.91
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.91
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.9
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.89
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.88
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.88
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.87
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.8
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.79
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.79
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.79
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.79
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.78
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.76
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.75
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.68
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.66
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.64
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.63
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.61
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.6
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.59
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.55
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.53
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.52
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.52
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.51
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.49
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.49
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.44
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.41
KOG0122270 consensus Translation initiation factor 3, subunit 99.38
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.37
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.37
KOG0122270 consensus Translation initiation factor 3, subunit 99.36
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.35
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.32
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.29
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.28
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.28
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.26
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.26
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.25
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.24
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.23
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.22
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.22
PLN03120260 nucleic acid binding protein; Provisional 99.2
PLN03120260 nucleic acid binding protein; Provisional 99.19
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.18
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.16
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.15
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.14
KOG4207256 consensus Predicted splicing factor, SR protein su 99.13
KOG4207256 consensus Predicted splicing factor, SR protein su 99.13
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.13
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.13
PLN03213759 repressor of silencing 3; Provisional 99.12
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.12
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.11
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.11
smart0036272 RRM_2 RNA recognition motif. 99.11
PLN03213 759 repressor of silencing 3; Provisional 99.1
PLN03121243 nucleic acid binding protein; Provisional 99.09
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.09
smart0036272 RRM_2 RNA recognition motif. 99.08
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.07
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.05
smart0036071 RRM RNA recognition motif. 99.05
PLN03121243 nucleic acid binding protein; Provisional 99.05
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 99.05
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.04
smart0036071 RRM RNA recognition motif. 99.03
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 99.03
KOG4660549 consensus Protein Mei2, essential for commitment t 99.03
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.99
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.99
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.97
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.96
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.94
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.91
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.86
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.86
smart0036170 RRM_1 RNA recognition motif. 98.84
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.84
smart0036170 RRM_1 RNA recognition motif. 98.82
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.81
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.79
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.72
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.69
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.66
KOG4210285 consensus Nuclear localization sequence binding pr 98.59
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.59
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.57
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.54
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.54
KOG4210285 consensus Nuclear localization sequence binding pr 98.52
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.51
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.45
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.41
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.4
KOG0226290 consensus RNA-binding proteins [General function p 98.39
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.39
KOG0226290 consensus RNA-binding proteins [General function p 98.36
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.25
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.24
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.21
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.21
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.2
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.12
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.06
KOG0151 877 consensus Predicted splicing regulator, contains R 98.01
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.98
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.9
KOG0151877 consensus Predicted splicing regulator, contains R 97.86
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.84
KOG4660549 consensus Protein Mei2, essential for commitment t 97.76
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.74
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.68
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.68
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.67
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.47
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.46
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.07
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.07
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.03
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.8
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.68
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.58
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.47
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.25
KOG2314698 consensus Translation initiation factor 3, subunit 96.23
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.22
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.02
KOG3152278 consensus TBP-binding protein, activator of basal 95.96
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 95.93
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.8
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.78
KOG2314 698 consensus Translation initiation factor 3, subunit 95.75
KOG1855484 consensus Predicted RNA-binding protein [General f 95.69
KOG3152278 consensus TBP-binding protein, activator of basal 95.55
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 95.4
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 95.31
KOG1855484 consensus Predicted RNA-binding protein [General f 95.0
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 94.95
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.94
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.83
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.43
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 94.41
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.93
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 93.79
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.61
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 92.45
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 91.88
PF15023166 DUF4523: Protein of unknown function (DUF4523) 91.03
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.87
KOG2591684 consensus c-Mpl binding protein, contains La domai 90.79
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 90.1
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 90.08
KOG2068327 consensus MOT2 transcription factor [Transcription 89.25
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 88.3
KOG2068327 consensus MOT2 transcription factor [Transcription 87.76
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 85.64
KOG2591684 consensus c-Mpl binding protein, contains La domai 84.72
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 84.56
KOG2135526 consensus Proteins containing the RNA recognition 84.41
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 84.34
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 82.47
KOG2135526 consensus Proteins containing the RNA recognition 80.93
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 80.04
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=2.4e-64  Score=542.72  Aligned_cols=508  Identities=39%  Similarity=0.573  Sum_probs=385.4

Q ss_pred             cEEEEcCCCccchHHHHHHHhhcCCCeEEEEeeCCchhhhhccccCCCCCccEEEEEeCCHHHHHHHHHHhCCceecCeE
Q 002709          122 RTVIIGGLLNADMAEEVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYTTVKSACASVALLHQKEIKGGT  201 (890)
Q Consensus       122 rtv~V~nLp~~~te~~L~~~F~~~G~V~~v~i~~~k~~~~~~~~~~~g~s~g~afV~F~s~e~A~~Ai~~ln~~~i~g~~  201 (890)
                      .||||++||++++.++|.++|+.+|+|..|.++.++.         ++.++|||||.|.-.+|++.|++.+++..|.|+.
T Consensus         6 ~TlfV~~lp~~~~~~qL~e~FS~vGPik~~~vVt~~g---------s~~~RGfgfVtFam~ED~qrA~~e~~~~kf~Gr~   76 (678)
T KOG0127|consen    6 ATLFVSRLPFSSTGEQLEEFFSYVGPIKHAVVVTNKG---------SSEKRGFGFVTFAMEEDVQRALAETEQSKFEGRI   76 (678)
T ss_pred             ceEEEecCCCccchhHHHHhhhcccCcceeEEecCCC---------cccccCccceeeehHhHHHHHHHHhhcCccccee
Confidence            7999999999999999999999999999999987763         6778999999999999999999999999999999


Q ss_pred             EEEecCCCC------------------------CC--CCCCcEEEEccCCCCCCHHHHHHhhccCCCeEEEEEcccCCCC
Q 002709          202 VWARQLGGE------------------------GS--KTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTG  255 (890)
Q Consensus       202 i~v~~~~~~------------------------~~--~~~~~~l~V~nLp~~~te~~L~~~F~~~G~I~~v~i~~~~~~g  255 (890)
                      |.+.+....                        ..  ....++|+|+|||+.+...+|..+|+.||.|+.|.||+... |
T Consensus        77 l~v~~A~~R~r~e~~~~~e~~~veK~~~q~~~~k~~v~~~k~rLIIRNLPf~~k~~dLk~vFs~~G~V~Ei~IP~k~d-g  155 (678)
T KOG0127|consen   77 LNVDPAKKRARSEEVEKGENKAVEKPIEQKRPTKAKVDLPKWRLIIRNLPFKCKKPDLKNVFSNFGKVVEIVIPRKKD-G  155 (678)
T ss_pred             cccccccccccchhcccccchhhhcccccCCcchhhccCccceEEeecCCcccCcHHHHHHHhhcceEEEEEcccCCC-C
Confidence            987442100                        01  22368999999999999999999999999999999998765 5


Q ss_pred             CcceEEEEEecCHHHHHHHHHHhCCceeCCeeEEEEeecCCCCcCCCCCCCCccccccCCCCCCCCCCCCCCCCCCCc--
Q 002709          256 LSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVPKNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDD--  333 (890)
Q Consensus       256 ~~~g~afV~F~~~e~A~~Al~~lng~~l~g~~I~V~~a~pk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  333 (890)
                      +-.|||||+|....+|..||+.+|+..|.|++|.|+||.++..|.........   ..........+.+. +++.+++  
T Consensus       156 klcGFaFV~fk~~~dA~~Al~~~N~~~i~gR~VAVDWAV~Kd~ye~ta~~~~~---s~Kk~~~eEed~e~-~~d~~~~~~  231 (678)
T KOG0127|consen  156 KLCGFAFVQFKEKKDAEKALEFFNGNKIDGRPVAVDWAVDKDTYEDTAHEEKQ---SLKKAVKEEEDKEA-DEDDGKDFD  231 (678)
T ss_pred             CccceEEEEEeeHHHHHHHHHhccCceecCceeEEeeecccccccccchhhhh---hhhhccchhhhccc-ccccccccc
Confidence            55599999999999999999999999999999999999999988765433200   00000000000000 0000000  


Q ss_pred             -ccccCCCCCCccccCCCCCCCchhHHHHHHHHhhhcccCCCCCCCCCCchhhccCCCCCCCchhhcccccccccccccc
Q 002709          334 -AETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGSLPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNS  412 (890)
Q Consensus       334 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~p~~~  412 (890)
                       .++..+ ....+..+..+. .+.                              .+.....++...++.+ .++..    
T Consensus       232 ~Ed~e~d-~edeEe~D~~se-~~e------------------------------e~~~~Eee~~~vDd~e-~S~~~----  274 (678)
T KOG0127|consen  232 EEDGEED-SEDEEETDGNSE-AFE------------------------------EGEESEEEEDDVDDEE-SSGKK----  274 (678)
T ss_pred             hhccccc-ccccccccccch-hhh------------------------------cccccccccccccccc-ccccC----
Confidence             000101 110010000000 000                              0000000000000000 01110    


Q ss_pred             CCCCCCcccccCCCCCCCCeEEEcCCCCCCCHHHHHHHHhhCCCeEEEEEeecCCCCCCCceEEEEECCHHHHHHHHHHh
Q 002709          413 SKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFGEVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSAS  492 (890)
Q Consensus       413 ~~~~~~~~~~~~~~~~~~~~l~V~NLp~~~tee~L~~~F~~fG~I~~v~i~~~~~~g~~~g~aFV~F~~~e~A~~Ai~~l  492 (890)
                      ........+....+...+.+|||+|||+++|+++|.++|++||.|.++.|+.++.|+.+.|+|||.|.+..+|+.||.+.
T Consensus       275 ~~~k~~q~k~~~en~~~~~tVFvRNL~fD~tEEel~~~fskFG~v~ya~iV~~k~T~~skGtAFv~Fkt~~~~~~ci~~A  354 (678)
T KOG0127|consen  275 ESDKKAQNKTTRENITEGKTVFVRNLPFDTTEEELKEHFSKFGEVKYAIIVKDKDTGHSKGTAFVKFKTQIAAQNCIEAA  354 (678)
T ss_pred             cccchhccccccccccccceEEEecCCccccHHHHHHHHHhhccceeEEEEeccCCCCcccceEEEeccHHHHHHHHHhc
Confidence            00000111112335667899999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccCCCCC-eeecCeEEEEEEccChhhhchhhhhhhccccccccchhhhccccccCCCCCCCCCChhhHHHHHHHHHHhhh
Q 002709          493 KTTSGLG-IFLKGRQLTVLKALDKKLAHDKEIDKSKNETNDHRNLYLAKEGLILEGTPAAEGVSDDDMSKRQMLHEKKMT  571 (890)
Q Consensus       493 n~~~~~g-~~l~Gr~l~V~~a~~k~~~~~~~~~~~~~~~~~~~~l~l~~eg~~~~~~p~a~~~s~~~~~~r~~~~~~~~~  571 (890)
                      ..+++.| +.|+||.|.|..|..+..+.+.+..+......+++||||..+|.|.+++|++.++|..||..|....+.+..
T Consensus       355 spa~e~g~~ll~GR~Lkv~~Av~RkeA~dmeqkk~~Kk~~gkrNLyLa~EG~I~~gt~aAeglS~~Dm~kRer~~~~k~k  434 (678)
T KOG0127|consen  355 SPASEDGSVLLDGRLLKVTLAVTRKEAADMEQKKKRKKPKGKRNLYLAREGLIRDGTPAAEGLSATDMAKRERIAERKRK  434 (678)
T ss_pred             CccCCCceEEEeccEEeeeeccchHHHHHHHHHhhhhccCCccceeeeccCccccCChhhcccchhhHHHHHHHHHHHHH
Confidence            6666666 999999999999999999999888888888899999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCccCeEEEeCCCCCCCHHHHHHHHHHHHhhhhccCCCCeEEEEEeecccCCccCCCCCcceEEEEEeCCHHH
Q 002709          572 KLQSPNFHVSRTRLVIYNLPKSMTEKGLKKLCIDAVVSRASKQKPVIKQIKFLQSLKKGKVDTKHYSRGVAFVEFTEHQH  651 (890)
Q Consensus       572 ~~~~p~~~~s~~~L~V~NLP~~~teeeL~~lF~~~~~~~~~~~~G~I~~v~i~rd~~~~~~~~~~~srG~aFV~F~t~e~  651 (890)
                      .+.+|++|+|.|+|.|+|||..++...|..|...+++.++++.-..|..+..+....      .+.+.||+||.|..|++
T Consensus       435 ~lknpnlhlSrtRL~i~Nlpramn~KqL~~Ll~~Av~~~at~~kk~~R~~~~le~~~------k~~s~g~aF~~f~EhEh  508 (678)
T KOG0127|consen  435 KLKNPNLHLSRTRLVIRNLPRAMNPKQLNRLLRDAVTGFATKVKKCIRQIKFLEEEK------KNYSEGYAFVGFTEHEH  508 (678)
T ss_pred             hhcCCceeeehhhhhhhcCccccCHHHHHHHHHHHHhhhhhhcchhhhhhhhHHhhh------hcccccccccCccHHHH
Confidence            999999999999999999999999999999999999988776444344333333222      34789999999999999


Q ss_pred             HHHHHHHhcCCCCCCCCCCccEEEEecccHHHHHHHHHHHHHHHh
Q 002709          652 ALVALRVLNNNPKTFGPEHRPIVEFAVDNVQTLKQRNAKIQAQQQ  696 (890)
Q Consensus       652 A~~Al~~Lng~~~~~g~~~rliV~~A~e~~~~~~~r~~~~q~~~~  696 (890)
                      |+.|++.+       |.-++++|+|+.+++   ..++.+.|..+|
T Consensus       509 alkalk~~-------G~lkq~~Vefev~~~---k~~~sk~q~f~q  543 (678)
T KOG0127|consen  509 ALKALKVL-------GVLKQAKVEFEVDGV---KAGRSKGQGFQQ  543 (678)
T ss_pred             HHHhhhcc-------cccccceEEEEeccc---hhhhhhhhhHHH
Confidence            99999887       334899999999886   344444444444



>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query890
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 3e-09
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 7e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 3e-09
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 7e-06
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 2e-08
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 4e-08
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 9e-08
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 3e-04
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-07
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 3e-07
2hyi_B91 Structure Of The Human Exon Junction Complex With A 5e-07
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 6e-07
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 7e-07
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 7e-07
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 8e-07
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 1e-06
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 1e-06
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 2e-06
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 4e-06
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 4e-06
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 6e-06
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 1e-05
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 2e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 4e-05
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 4e-05
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 4e-05
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 5e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 6e-05
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 6e-05
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 7e-05
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 7e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 1e-04
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 1e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 2e-04
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 2e-04
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 3e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 3e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 4e-04
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 5e-04
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 5e-04
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 6e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 6e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 7e-04
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 8e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 8e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 9e-04
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure

Iteration: 1

Score = 61.2 bits (147), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 51/175 (29%), Positives = 79/175 (45%), Gaps = 12/175 (6%) Query: 122 RTVIIGGLLNADMAE-EVHRLAGSIGTVCSVTYPLPKEELEQHGLAQEGCKMDASAVLYT 180 RT +I L +M + E+ L SIG V S L ++++ H L V Y Sbjct: 2 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAK--LIRDKVAGHSLGY-------GFVNYV 52 Query: 181 TVKSACASVALLHQKEIKGGTVWARQLGGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPV 240 T K A ++ L+ ++ T+ + L I +P +++DMFS Sbjct: 53 TAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRF 112 Query: 241 GLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQK--FGKRPIAVDWA 293 G + N + + TGLS+G AF++F + +AE AI FNG K PI V +A Sbjct: 113 GRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFA 167
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query890
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-25
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 6e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-22
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 6e-18
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-06
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-21
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 8e-13
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-06
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-21
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 3e-15
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-06
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-21
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-11
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-21
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-15
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-21
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-20
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-14
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-06
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-20
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-13
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-20
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 8e-04
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-20
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-10
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-19
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-12
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-19
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-19
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-12
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-05
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-19
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-15
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-19
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 8e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-19
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-16
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-07
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 8e-19
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-08
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-18
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-06
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-18
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-13
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-18
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-04
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-07
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-18
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-06
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-18
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-06
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-18
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-14
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-18
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 8e-08
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 7e-18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-15
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-15
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 9e-18
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-11
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 9e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 9e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 9e-18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-17
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-17
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-11
2cpj_A99 Non-POU domain-containing octamer-binding protein; 6e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-11
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-05
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-04
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-14
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-17
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-14
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 8e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-17
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 9e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-17
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-13
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-17
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-11
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-07
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-17
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 7e-12
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 6e-17
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-04
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 7e-17
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-06
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-16
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-12
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-07
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-12
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-16
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-16
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-05
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-16
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-07
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-16
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-16
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 6e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-16
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-14
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-09
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-07
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-16
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-09
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-09
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-06
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 5e-16
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 5e-11
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 6e-04
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 7e-06
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-16
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-07
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-16
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 9e-11
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 7e-16
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 7e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-12
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-07
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 8e-16
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-14
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 8e-16
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-13
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-04
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 9e-16
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-15
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-15
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-11
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-15
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-09
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-06
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-15
1x4e_A85 RNA binding motif, single-stranded interacting pro 4e-12
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-15
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-15
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-11
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-04
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-15
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 9e-06
2div_A99 TRNA selenocysteine associated protein; structural 6e-15
2div_A99 TRNA selenocysteine associated protein; structural 6e-09
2div_A99 TRNA selenocysteine associated protein; structural 2e-04
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 9e-14
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-07
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-15
2kt5_A124 RNA and export factor-binding protein 2; chaperone 6e-12
2kt5_A124 RNA and export factor-binding protein 2; chaperone 8e-08
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-15
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 8e-15
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 8e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-06
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-05
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-15
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-09
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 9e-15
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-07
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 9e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 8e-06
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-14
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-08
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-14
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-06
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-14
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-10
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-10
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-07
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-07
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-10
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 7e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-14
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-10
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-06
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-14
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-11
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-14
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-14
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 6e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-08
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-08
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-11
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-07
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-14
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-07
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-14
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-11
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 8e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-14
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-12
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 7e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-14
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 7e-11
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-04
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-06
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-14
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-08
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 6e-14
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-07
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-14
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 5e-04
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-14
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-12
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-14
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-05
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-05
1x5o_A114 RNA binding motif, single-stranded interacting pro 9e-14
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-11
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-14
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-09
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-13
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 2e-13
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-13
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 9e-09
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-08
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-11
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-13
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-10
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-08
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-06
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-13
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-09
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-13
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 9e-13
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 5e-08
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 9e-13
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-11
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-08
1x5p_A97 Negative elongation factor E; structure genomics, 1e-12
1x5p_A97 Negative elongation factor E; structure genomics, 4e-07
1x5p_A97 Negative elongation factor E; structure genomics, 9e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-12
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-09
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 6e-12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-08
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-12
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-08
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 4e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-04
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-08
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 9e-12
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 6e-07
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-08
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-11
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-04
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 4e-05
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-08
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-11
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-07
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 6e-11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 8e-11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 9e-11
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 6e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 9e-06
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-10
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-06
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-10
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 5e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-06
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-07
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-10
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-10
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 4e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-06
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 6e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 7e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-09
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-07
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-09
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 7e-06
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-09
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 7e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 6e-09
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 4e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 7e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 9e-08
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 6e-06
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-06
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 1e-06
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 1e-06
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-06
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 4e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-05
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-05
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-05
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 5e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 8e-05
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 4e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 7e-04
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
 Score =  101 bits (253), Expect = 1e-25
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 208 GGEGSKTQKWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHN-TDTGLSKGFAFVKFT 266
           G    K    K+++RNIPF+A   EI+++FS  G +  V +P   T TG  +GF FV F 
Sbjct: 7   GQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFI 66

Query: 267 CKRDAESAIQK-FNGQKFGKRPIAVDWAVPKNIYSSGGAAA 306
            K+DA+ A     +      R + ++WA  +    SG ++ 
Sbjct: 67  TKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG 107


>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 890
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-17
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 6e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 0.003
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 0.004
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 9e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-05
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-15
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 7e-04
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.004
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 0.003
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-14
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-06
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-14
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-04
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-14
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-14
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.003
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-14
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 0.002
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-14
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 7e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-14
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 0.002
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-13
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 6e-08
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-09
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-13
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-13
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 8e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-13
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-13
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 0.001
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 7e-12
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-12
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-07
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-11
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-05
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 9e-05
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 5e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-11
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 9e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 5e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-05
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 0.004
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 6e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-04
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 8e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-10
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 6e-05
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 0.002
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 4e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-10
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-09
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-05
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 7e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-09
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 0.004
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-09
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 7e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 0.003
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 4e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 5e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.001
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 9e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-04
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 9e-04
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 3e-06
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 3e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 5e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.001
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 6e-06
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 0.002
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 8e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 9e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 9e-05
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 0.001
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 7e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 2e-04
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.0 bits (184), Expect = 3e-17
 Identities = 18/76 (23%), Positives = 35/76 (46%)

Query: 218 KLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQK 277
            L + ++        + + FSP G + ++ +  +  T  S G+A+V F    DAE A+  
Sbjct: 2   SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDT 61

Query: 278 FNGQKFGKRPIAVDWA 293
            N      +P+ + W+
Sbjct: 62  MNFDVIKGKPVRIMWS 77


>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query890
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.77
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.77
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.76
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.76
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.76
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.76
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.75
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.75
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.75
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.72
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.72
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.72
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.72
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.72
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.71
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.71
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.71
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.71
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.7
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.7
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.7
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.7
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.69
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.69
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.69
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.69
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.68
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.68
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.66
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.65
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.65
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.65
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.65
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.65
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.65
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.63
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.63
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.63
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.63
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.63
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.63
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.62
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.62
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.62
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.61
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.61
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.61
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.6
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.6
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.6
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.6
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.6
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.6
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.6
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.6
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.6
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.6
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.59
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.59
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.59
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.59
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.58
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.58
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.58
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.58
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.58
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.58
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.57
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.57
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.57
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.57
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.57
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.57
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.57
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.57
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.57
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.56
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.56
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.56
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.56
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.55
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.55
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.55
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.54
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.54
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.54
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.54
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.54
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.53
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.52
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.52
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.5
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.49
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.49
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.49
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.45
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.4
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.39
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.35
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.35
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.33
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.32
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.32
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.31
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.31
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.28
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.26
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.17
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.15
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.14
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.12
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.32
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.1
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.43
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.32
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.18
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.07
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.75
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 93.78
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.2e-32  Score=201.77  Aligned_cols=174  Identities=20%  Similarity=0.333  Sum_probs=137.8

Q ss_pred             CCEEEECCCCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCEECCEEEEEEEECC
Q ss_conf             94999926999998999998513599847999820499998202999994499999999999489354982179996158
Q 002709          216 KWKLIIRNIPFKAKVNEIKDMFSPVGLVWNVYIPHNTDTGLSKGFAFVKFTCKRDAESAIQKFNGQKFGKRPIAVDWAVP  295 (890)
Q Consensus       216 ~~~i~V~nLp~~~tee~L~~~F~~~G~I~~v~i~~d~~tg~~~G~AfV~F~~~e~A~~Al~~lng~~l~g~~i~V~~a~p  295 (890)
                      .++|||+|||+.+++++|+++|++||.|.++.++++..++.++|||||+|.+.++|..|+. +++..+..+.+.+.+..+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCEECCCCCHHHHHHHHH-HCCCCCCCCCHHHHHHHH
T ss_conf             9789997989989899999999873987899864112478855743220488899999998-457764111023333221


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             98768899898853246578899999999999999986556678899853368999988406899999985110367899
Q 002709          296 KNIYSSGGAAAGAYEDGVQNKGDGNSDSGSDDDLGDDDAETASDDSNSSEKEDLPSNADFDEEVDIARKVLNKLTSTTGS  375 (890)
Q Consensus       296 k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  375 (890)
                      .......                                                                         
T Consensus        85 ~~~~~~~-------------------------------------------------------------------------   91 (183)
T d1u1qa_          85 REDSQRP-------------------------------------------------------------------------   91 (183)
T ss_dssp             TTGGGST-------------------------------------------------------------------------
T ss_pred             CCCCCCC-------------------------------------------------------------------------
T ss_conf             1231101-------------------------------------------------------------------------


Q ss_pred             CCCCCCCHHHCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHCC
Q ss_conf             99998730100498777872000000122443334668899976554578899988599839999999999999986079
Q 002709          376 LPSLSDDSALVKGNKEQDSDKTVNESAKVSDVSKLNSSKSKPKSLKQTEGEDELQNTIFICNLPFDLDNEEVKQRFSAFG  455 (890)
Q Consensus       376 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~v~p~~~~~~~~~~~~~~~~~~~~~~~i~V~NLp~~~teeeL~~~F~~fG  455 (890)
                                                                       ......++|||+|||+.+|+++|+++|+.||
T Consensus        92 -------------------------------------------------~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G  122 (183)
T d1u1qa_          92 -------------------------------------------------GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYG  122 (183)
T ss_dssp             -------------------------------------------------TTTCCCSEEEEECCCTTCCHHHHHHHHGGGS
T ss_pred             -------------------------------------------------CCCCCCCEEEECCCCCCCCHHHHHHHHCCCC
T ss_conf             -------------------------------------------------1345642358816777678999965431588


Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCCCEEECCEEEEEEECCCHHHH
Q ss_conf             817999954278999873689997899999999998133799772561818999992370111
Q 002709          456 EVVSFVPVLHQVTKRPKGTGFLKFKTVEAATAAVSASKTTSGLGIFLKGRQLTVLKALDKKLA  518 (890)
Q Consensus       456 ~I~~v~i~~~~~~g~~kg~aFV~F~~~e~A~~Ai~~ln~~~~~g~~l~Gr~l~V~~a~~k~~~  518 (890)
                      .|..+.++.+..++.++|||||+|.+.++|.+|+. ++     +..+.|+.|.|.||.+|.+.
T Consensus       123 ~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~-----~~~~~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         123 KIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QK-----YHTVNGHNCEVRKALSKQEM  179 (183)
T ss_dssp             CEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SS-----CEEETTEEEEEEECCCHHHH
T ss_pred             CEEEEEEECCCCCCCCCEEEEEEECCHHHHHHHHH-HC-----CCEECCEEEEEEECCCCCCC
T ss_conf             65322330026668501059999789999999998-59-----99099979799966884424



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure