Citrus Sinensis ID: 002810


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------
MTIRDSSVLMMENGGSCLPCTPDEERQIVQDLKNQSDLDLKEGNLYFLISTRWYRSWERYVCGDEPSIDNISFDSPHMNGVSSKRAERPGPIDNSDIIQNGNGSSEGDDLEVRRNLEEGQDYVLVPQQVWEKLFCWYKGGPALPRKMISEGIVNEKRVEVFXLCLKLIDSRDNSQTVIRLSKKASTRQLYEKVCKLRGIEQEKARIWDYFNKQRSTSPLDVSDQTLDDAMLQMDQDILLEVQVDNGISMDSTGNDLALVPIEPSRSSLTIAGGPALSNGHTTGYRFNQYPGSSFGSTFMDMDDGYDSYNTAKKGEKGGLAGLQNLGNTCFMNSALQCLVHTPDLAQYFLGDYSDEINTENPLGMHGELALAFGDLLRKLWSSGRAAVAPRAFKGKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNRVKQKPYIEMKDSGGRPDEEVANECWKNHKARNDSLIVDVFQGQYKSTLVCPVCSKVSITFDPFMYLTLPLPSTVTRTMTVTVFYANGSGLPMPFTVTLMKHGCCKDLILALSTACCLKIDEGLLLAEVYNHQIFRFFENPAELISSIKDDEHIVAYRFDRKQGGKIKLEIVNRWQEKSASDYLKGSERKLFGAPLVTYLEEEHLSGADIDIAVSKLLSPLRRTYSSAKAHGGKENGFLPEVIDELSNSHNESVETAELEDLCSRELSFQLSLTDERISSCKPIQKDSILKPGKHIKVLLDWTDDVHELYDPSYIKDLPVVHKTGFTVKKTRQEAISLFSCLDAFLTEEPLGPDDMWYCPQCKEHRQATKKLDLWMLPDVLVFHLKRFSYSRYLKNKLDTFVNFPILNLDLSKYMKSKDGESYVYDLFAISNHYGGLGGGHYTAYAKVNA
ccccccHHHHHccccccccccHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHcccccccccEEEcccccEEEEEEcccEEEEEEcccccccEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccccccccccccHHHHHHccccEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccccEEEcccccccEEEcccccccECcccccccEEEEEEEEECccccccccEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEcccEEEEEcccHHccccccccccEEEEEEcccccccEEEEEEEEEEEccccccccccccccccccEEEECccccccHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccEEEEEEEccccHHHHHHHcccccccccccccccEEECcccccccccccccccccccEEEEEEEECcccccccccEEEcccccc
**************************QIVQDLKNQSDLDLKEGNLYFLISTRWYRSWERYVCGDEPSI*********************GPIDNSDIIQNGNGSSEGDDLEVRRNLEEGQDYVLVPQQVWEKLFCWYKGGPALPRKMISEGIVNEKRVEVFXLCLKLIDSRDNSQTVIRLSKKASTRQLYEKVCKLRGIEQEKARIWDYFNK************TLDDAMLQMDQDILLEVQVDNGIS********************************************************************GGLAGLQNLGNTCFMNSALQCLVHTPDLAQYFLGDYSDEINTENPLGMHGELALAFGDLLRKLWSSGRAAVAPRAFKGKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNRV********************NECWKNHKARNDSLIVDVFQGQYKSTLVCPVCSKVSITFDPFMYLTLPLPSTVTRTMTVTVFYANGSGLPMPFTVTLMKHGCCKDLILALSTACCLKIDEGLLLAEVYNHQIFRFFENPAELISSIKDDEHIVAYRFDRKQGGKIKLEIVNRWQEKSASDYLKGSERKLFGAPLVTYLEEEHLSGADIDIAVSKLLSPLRRTYSSAKAHGGKENGFLPEVIDELSN************DLCSRELSFQLSLTDERISSCKPIQKDSILKPGKHIKVLLDWTDDVHELYDPSYIKDLPVVHKTGFTV**TRQEAISLFSCLDAFLTEEPLGPDDMWYCPQCKEHRQATKKLDLWMLPDVLVFHLKRFSYSRYLKNKLDTFVNFPILNLDLSKYMKSKDGESYVYDLFAISNHYGGLGGGHYTAYAKVN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIRDSSVLMMENGGSCLPCTPDEERQIVQDLKNQSDLDLKEGNLYFLISTRWYRSWERYVCGDEPSIDNISFDSPHMNGVSSKRAERPGPIDNSDIIQNGNGSSEGDDLEVRRNLEEGQDYVLVPQQVWEKLFCWYKGGPALPRKMISEGIVNEKRVEVFXLCLKLIDSRDNSQTVIRLSKKASTRQLYEKVCKLRGIEQEKARIWDYFNKQRSTSPLDVSDQTLDDAMLQMDQDILLEVQVDNGISMDSTGNDLALVPIEPSRSSLTIAGGPALSNGHTTGYRFNQYPGSSFGSTFMDMDDGYDSYNTAKKGEKGGLAGLQNLGNTCFMNSALQCLVHTPDLAQYFLGDYSDEINTENPLGMHGELALAFGDLLRKLWSSGRAAVAPRAFKGKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNRVKQKPYIEMKDSGGRPDEEVANECWKNHKARNDSLIVDVFQGQYKSTLVCPVCSKVSITFDPFMYLTLPLPSTVTRTMTVTVFYANGSGLPMPFTVTLMKHGCCKDLILALSTACCLKIDEGLLLAEVYNHQIFRFFENPAELISSIKDDEHIVAYRFDRKQGGKIKLEIVNRWQEKSASDYLKGSERKLFGAPLVTYLEEEHLSGADIDIAVSKLLSPLRRTYSSAKAHGGKENGFLPEVIDELSNSHNESVETAELEDLCSRELSFQLSLTDERISSCKPIQKDSILKPGKHIKVLLDWTDDVHELYDPSYIKDLPVVHKTGFTVKKTRQEAISLFSCLDAFLTEEPLGPDDMWYCPQCKEHRQATKKLDLWMLPDVLVFHLKRFSYSRYLKNKLDTFVNFPILNLDLSKYMKSKDGESYVYDLFAISNHYGGLGGGHYTAYAKVNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 10 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.probableQ9ZSB5
Ubiquitin carboxyl-terminal hydrolase 4 Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. Plays a role in the regulation of quality control in the ER.probableP35123
Ubiquitin carboxyl-terminal hydrolase 4 Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. Plays a role in the regulation of quality control in the ER.probableA6QR55

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 330-500,762-876
View the alignment between query and template
View the model in PyMOL
Template: 3JYU, chain A
Confidence level:very confident
Coverage over the Query: 16-246
View the alignment between query and template
View the model in PyMOL
Template: 2YLM, chain A
Confidence level:confident
Coverage over the Query: 460-605,616-646
View the alignment between query and template
View the model in PyMOL