Citrus Sinensis ID: 002824
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 876 | 2.2.26 [Sep-21-2011] | |||||||
| Q55FD6 | 688 | PHD finger-containing pro | yes | no | 0.176 | 0.225 | 0.322 | 5e-18 | |
| Q6P2L6 | 1439 | Histone-lysine N-methyltr | yes | no | 0.139 | 0.084 | 0.325 | 6e-13 | |
| O88491 | 2588 | Histone-lysine N-methyltr | no | no | 0.173 | 0.058 | 0.280 | 4e-12 | |
| Q8BVE8 | 1365 | Histone-lysine N-methyltr | no | no | 0.171 | 0.109 | 0.301 | 8e-12 | |
| Q96L73 | 2696 | Histone-lysine N-methyltr | no | no | 0.173 | 0.056 | 0.280 | 1e-11 | |
| Q9BZ95 | 1437 | Histone-lysine N-methyltr | no | no | 0.139 | 0.084 | 0.306 | 1e-11 | |
| O96028 | 1365 | Histone-lysine N-methyltr | no | no | 0.140 | 0.090 | 0.305 | 1e-10 |
| >sp|Q55FD6|Y8158_DICDI PHD finger-containing protein DDB_G0268158 OS=Dictyostelium discoideum GN=DDB_G0268158 PE=4 SV=1 | Back alignment and function desciption |
|---|
Score = 94.0 bits (232), Expect = 5e-18, Method: Compositional matrix adjust.
Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 28/183 (15%)
Query: 199 DWNEDEDSERVDKDENYFAVCAICDDGGDVTFCDGRCLRSFHATITAGKNALCQSLGYTQ 258
+ N+D+ +R K+E AVC C+ G++ CDG CLRSFH + +N S
Sbjct: 122 ETNDDDKPKRPRKNE---AVCTFCEKPGELLMCDGLCLRSFHISCLKARNLYNPSSSSIS 178
Query: 259 --AQIDAVPNFLCQNCVYQEHQCFAC---GMLGSSDKSSSQEVFPCVSATCGQFYHPECV 313
ID + C +CV ++ CF+C G++G ++ C CG+FYH +CV
Sbjct: 179 PVTTIDGTVRWECNDCVSSQNSCFSCKKRGIIGI-------DLMKCKVHQCGKFYHYKCV 231
Query: 314 SKLLHPDNESLAEELRERIAAGESFTCPVHKCFVCQQSEDMNVEDLQLAICRRCPKAYHR 373
+ + LA+ + + F CP+H C VC+ S D Q C RCP AYH
Sbjct: 232 A------DYKLAKLINTKTPR---FNCPLHYCSVCEVSGDGK----QSVHCFRCPTAYHV 278
Query: 374 KCL 376
C+
Sbjct: 279 ICM 281
|
Dictyostelium discoideum (taxid: 44689) |
| >sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 876 | ||||||
| 225446989 | 1216 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.714 | 0.561 | 0.0 | |
| 359494102 | 1260 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.684 | 0.547 | 0.0 | |
| 147814981 | 2238 | hypothetical protein VITISV_020586 [Viti | 0.985 | 0.385 | 0.547 | 0.0 | |
| 297737514 | 1201 | unnamed protein product [Vitis vinifera] | 0.936 | 0.682 | 0.540 | 0.0 | |
| 255576262 | 1249 | protein binding protein, putative [Ricin | 0.987 | 0.692 | 0.512 | 0.0 | |
| 356569700 | 1225 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.706 | 0.491 | 0.0 | |
| 357459829 | 1289 | hypothetical protein MTR_3g055370 [Medic | 0.987 | 0.671 | 0.461 | 0.0 | |
| 297739138 | 1025 | unnamed protein product [Vitis vinifera] | 0.745 | 0.637 | 0.589 | 0.0 | |
| 356499417 | 1065 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.802 | 0.467 | 0.0 | |
| 145359280 | 1297 | enhanced downy mildew 2 [Arabidopsis tha | 0.980 | 0.662 | 0.460 | 0.0 |
| >gi|225446989|ref|XP_002268363.1| PREDICTED: uncharacterized protein LOC100248222 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 986 bits (2548), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 505/899 (56%), Positives = 650/899 (72%), Gaps = 30/899 (3%)
Query: 1 MGYSEEDDDTLTLYVSDYEFLDQNEESISFSVLPLQWDGCDIVGSSEMQVFLHGNIGDGP 60
M S+E+ + L + DY F+D +E ISFS+LPLQW + +M +FL G+ DG
Sbjct: 1 MASSDEEGEILPNCIRDYYFVDYKDEPISFSILPLQWSKDENPDGLKMMIFLRGSAYDGL 60
Query: 61 WNFNEQVIAWKFELSYAQPEIWVLSKQNNWIMLQSPKKSFKNIVRTILITVHWLYCVKQN 120
+QVIAWKFELS +PEI+VLSK NW+ LQSP+KSF+NIVRTIL+TV WL+ VK+N
Sbjct: 61 QKIYKQVIAWKFELSSVEPEIFVLSKDKNWMELQSPRKSFQNIVRTILVTVSWLHFVKRN 120
Query: 121 PEASRKYIREQMLKVFCSYEVEPSENDLLDHMPISREAAERDKDLANSKFLLSFMANH-- 178
PEAS K + +LK F SYE EPSENDLLDHMP+ +EA +R++DL SK +L+++
Sbjct: 121 PEASGKSLWNHLLKSFSSYEFEPSENDLLDHMPLIQEAVKREEDLLKSKCMLTYLPEKTG 180
Query: 179 ------------PETNTFHEDVRTTEKPKVIVDWNEDEDSERVDKDEN--YFAVCAICDD 224
+N DV T + I D +++++ E D+D + + +VCAICD+
Sbjct: 181 GETALYEGSLVLSSSNIPSSDVHTMRRYTFIDDRDDNDEDEENDEDNDELFDSVCAICDN 240
Query: 225 GGDVTFCDGRCLRSFHATITAGKNALCQSLGYTQAQIDAVPNFLCQNCVYQEHQCFACGM 284
GG++ C+GRCLRSFHAT+ AG + C+SLG++ AQ++A+ NFLC+NC YQ+HQCF CGM
Sbjct: 241 GGELLCCEGRCLRSFHATVDAGTESFCESLGFSDAQVEAIQNFLCKNCQYQQHQCFVCGM 300
Query: 285 LGSSDKSSSQEVFPCVSATCGQFYHPECVSKLLHPDNESLAEELRERIAAGESFTCPVHK 344
LGSS++SS EVF C SATCG+FYHP CV+K LHP N LA+ L+ +IA G SFTCP+HK
Sbjct: 301 LGSSNESSGAEVFRCASATCGRFYHPYCVAKRLHPMNNILAKHLQNKIAGGVSFTCPLHK 360
Query: 345 CFVCQQSEDMNVEDLQLAICRRCPKAYHRKCLPTEITFS-DADENNFQRAWVDLLPNNRI 403
CFVC++ E+ V+DLQ A+CRRCPKAYHRKCLP I+F +EN QRAW+ LLPN RI
Sbjct: 361 CFVCKRGENKGVDDLQFALCRRCPKAYHRKCLPGNISFECIYNENIMQRAWIGLLPN-RI 419
Query: 404 LIYCLEHKIISELKTPARDHLKFPGVEGKRKKEDLELLLTEEKDVASKRNIVSESFVADK 463
LIYC+EHKI +L+TP R+H++FP E K KK EL + EK ++ KRNIVSE F A+
Sbjct: 420 LIYCMEHKINRKLRTPERNHIRFPDPESKGKKHVSELPSSNEKVMSKKRNIVSEIFPAES 479
Query: 464 TVVKKLKLAEVYSGADVGMSNSEIKKRWPRQDVHSLKKPNITDTGRKSLKDIADKSKP-- 521
T VK KL EV+ S +KR Q K I D +K L+D KS P
Sbjct: 480 TAVKMTKL-EVHRVVKDVDSTKFFEKRCSSQGFDPPTKQKINDATKKFLRDNV-KSVPVK 537
Query: 522 ---SLRKDSTLLKSRSFVVKPGHRNIDGSKMKNSISDRRRMKKVNISQPSVDAEMEKELL 578
S+ T R++ +KP +NI SK++ S + MK+ + SQP +DAE+E ++
Sbjct: 538 ICASVAVKGTQSSLRNYNIKPKQQNIP-SKVEKITSLKPSMKRASSSQPLMDAELETRIV 596
Query: 579 ALIKDSTSSFNEEEFMKSHIVPITHAHHSKHLLEKSITLGLVEGSVKAVRAALEMLDGGC 638
L+K +TSSF+ EEF + V ++ SK++L+ +IT G VE SVKA+R ALE L+ GC
Sbjct: 597 DLMKSTTSSFSLEEFREKQKVLCSY---SKNVLDSTITQGKVEVSVKAIRTALEKLEKGC 653
Query: 639 DIEDAKAVCPPEILCQIFQWKRKLDVYLAPFLHGMRYTSFGRHFTKVEKLKEIVDRLHWY 698
IEDAKAVC PE+L QI +WKRKL VYLAPFLHGMRYTSFGRHFTKVEKL+E+VDRLHWY
Sbjct: 654 SIEDAKAVCEPEVLNQIMRWKRKLKVYLAPFLHGMRYTSFGRHFTKVEKLREVVDRLHWY 713
Query: 699 VRSGDTIVDFCCGANDFSCMMKVKLEQMGKSCSFRNYDLIQPKNDFSFEKRDWMTVRPEE 758
V+ GD IVDFCCG+NDFSC+MK KL+++GKSCSF+NYDLIQPKNDFSFEKRDWM++ +E
Sbjct: 714 VQHGDMIVDFCCGSNDFSCLMKEKLDKVGKSCSFKNYDLIQPKNDFSFEKRDWMSIHLDE 773
Query: 759 LPDGSQLIMGLNPPFGVKASLANKFISQALKFKPKLIVLIVPQETRRLDQK-ASYNLIWE 817
LP GSQLIMGLNPPFGVKASLANKFI +AL F+PKL++LIVP+ET+RLD+K ++Y+LIWE
Sbjct: 774 LPAGSQLIMGLNPPFGVKASLANKFIDKALSFRPKLLILIVPKETKRLDEKDSAYDLIWE 833
Query: 818 DNEVLSGKSFYLPGSLDVHDNQLEQWNCKPPPLYLWSRADWTASHKKIALGRGHITVEE 876
D ++LSGKSFYLPGS+D+HD QLEQWN PP LYLWSR DWT+ HK +A GHI++E+
Sbjct: 834 DEDILSGKSFYLPGSVDMHDKQLEQWNLLPPLLYLWSRPDWTSRHKAVAQKCGHISIEQ 892
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359494102|ref|XP_002276879.2| PREDICTED: uncharacterized protein LOC100243584 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147814981|emb|CAN61366.1| hypothetical protein VITISV_020586 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737514|emb|CBI26715.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255576262|ref|XP_002529024.1| protein binding protein, putative [Ricinus communis] gi|223531504|gb|EEF33335.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356569700|ref|XP_003553034.1| PREDICTED: uncharacterized protein LOC100803073 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357459829|ref|XP_003600195.1| hypothetical protein MTR_3g055370 [Medicago truncatula] gi|355489243|gb|AES70446.1| hypothetical protein MTR_3g055370 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297739138|emb|CBI28789.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356499417|ref|XP_003518537.1| PREDICTED: uncharacterized protein LOC100806429 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|145359280|ref|NP_200350.2| enhanced downy mildew 2 [Arabidopsis thaliana] gi|334188424|ref|NP_001190545.1| enhanced downy mildew 2 [Arabidopsis thaliana] gi|332009240|gb|AED96623.1| enhanced downy mildew 2 [Arabidopsis thaliana] gi|332009241|gb|AED96624.1| enhanced downy mildew 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00027233001 | SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (1259 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 876 | |||
| pfam12047 | 143 | pfam12047, DNMT1-RFD, Cytosine specific DNA methyl | 1e-11 |
| >gnl|CDD|221394 pfam12047, DNMT1-RFD, Cytosine specific DNA methyltransferase replication foci domain | Back alignment and domain information |
|---|
Score = 63.1 bits (154), Expect = 1e-11
Identities = 26/132 (19%), Positives = 46/132 (34%), Gaps = 13/132 (9%)
Query: 7 DDDTLTLYVSDYEFLDQNEESISFSVLPLQWDGCDIVGSSEMQVF--------LHGNIGD 58
+D+ ++++ D + E S LP++ + D+ S ++ G
Sbjct: 1 EDERPQRKLTNFALYDSDGELCSLETLPIKKNV-DLFISGVIKPIYDDEPSLEGKGVRDK 59
Query: 59 GPWNFNEQVIAWKFELSYAQPEIWVLSKQNNWIMLQSPKKSFK----NIVRTILITVHWL 114
G F ++ W I LS W L P KS+ + +TV L
Sbjct: 60 GLEIFLGRIKEWTISGGDDGEPIIWLSTDFAWYKLLKPSKSYAPLYEPVFEKARVTVEVL 119
Query: 115 YCVKQNPEASRK 126
+K+NP
Sbjct: 120 KFLKRNPRVPDL 131
|
This domain is part of a cytosine specific DNA methyltransferase enzyme. It functions non-catalytically to target the protein towards replication foci. This allows the DNMT1 protein to methylate the correct residues. This domain targets DMAP1 and HDAC2 to the replication foci during the S phase of mitosis. They are thought to have some importance in conversion of critical histone lysine moieties. Length = 143 |
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 876 | |||
| PF12047 | 146 | DNMT1-RFD: Cytosine specific DNA methyltransferase | 99.77 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.02 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 97.95 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.83 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.71 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 97.55 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 97.51 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.42 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 97.42 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.35 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.34 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.28 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.28 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.18 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 97.17 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.13 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 96.81 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 96.8 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 96.78 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 96.67 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 96.58 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 96.28 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 95.96 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.93 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 95.9 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 95.67 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 95.5 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 95.47 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 94.88 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.8 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 94.76 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 94.49 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.13 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 93.74 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 93.39 | |
| KOG1701 | 468 | consensus Focal adhesion adaptor protein Paxillin | 93.08 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 93.04 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 91.85 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 91.58 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 91.1 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 90.9 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 90.16 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 89.56 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 89.02 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 87.52 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 86.14 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 85.0 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 84.96 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 84.12 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 83.31 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 83.2 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 82.26 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 81.76 | |
| PF07669 | 106 | Eco57I: Eco57I restriction-modification methylase; | 81.5 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 81.27 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 81.08 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 80.29 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 80.24 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 80.17 |
| >PF12047 DNMT1-RFD: Cytosine specific DNA methyltransferase replication foci domain; InterPro: IPR022702 This domain is part of a cytosine specific DNA methyltransferase enzyme | Back alignment and domain information |
|---|
Probab=99.77 E-value=5.1e-20 Score=179.27 Aligned_cols=131 Identities=24% Similarity=0.401 Sum_probs=100.7
Q ss_pred CCcccccccceeEeecCCCCeeEeEeeeeeecccccCCCCcceEEE----------ecccCCCccceeeeEEEEEeeccC
Q 002824 7 DDDTLTLYVSDYEFLDQNEESISFSVLPLQWDGCDIVGSSEMQVFL----------HGNIGDGPWNFNEQVIAWKFELSY 76 (876)
Q Consensus 7 ~~e~~~~~v~~y~f~d~~~~~v~fs~lp~~~~~~~~~~~~~~~v~l----------~G~~d~Gl~~v~~~v~aWr~~l~~ 76 (876)
|++.++..|+||+|.|++++||+|+.||++|+...-+.|..+.+++ +|..++|++.++++|++|.+++..
T Consensus 1 ~~~~p~r~L~~f~~~d~~~~~~~le~l~~~~~~~~~~sG~v~~~~~~~~~~~~~~~~g~~~~g~~~~l~~I~~W~i~~~~ 80 (146)
T PF12047_consen 1 EDDLPMRSLDDFSFYDSDGEPVSLELLPIEWNVDLFASGVVKPIGLWGDDEPSPKEKGVRDEGVRIRLGPIKEWWIDGGD 80 (146)
T ss_dssp -SSS-EEEEEEEEEEETTSBB--STTSTTTTT--EEEEEEEEETT-------SSTS-SEEEEC----ES-ECEEEEE-SS
T ss_pred CCCCcceEEEEEEEEeCCCCEEeeeeccccCCCcccceEEecccCcccccCccccccCccCCCcccceeceeEEEEEecC
Confidence 5788899999999999999999999999999998777777788887 799999999999999999999998
Q ss_pred CcceEEEEecCCceeEcCCCCch----HHHHHHHHhhhhheehhhccCcccchhHHHHHHHhhcc
Q 002824 77 AQPEIWVLSKQNNWIMLQSPKKS----FKNIVRTILITVHWLYCVKQNPEASRKYIREQMLKVFC 137 (876)
Q Consensus 77 ~~p~isvls~~~~Wi~L~kPrk~----ye~~irtvlitv~~LhfvkknP~~s~ksl~~~L~K~f~ 137 (876)
..|.+.+++.+.+|++|+||+++ |+.++|++.||++++|+|++||..+..++|+.|.++++
T Consensus 81 ~~~~~i~i~T~~awY~L~kPs~~Y~~~y~~~~~~~~l~~~v~~~l~~~~~~~~~s~~d~l~~v~~ 145 (146)
T PF12047_consen 81 DGPPIIWISTDYAWYRLMKPSKSYAPWYEPFLRKARLTVRVIHFLKKNPRASDLSYEDLLARVFR 145 (146)
T ss_dssp SSS-EEEEEESS-EEEE-SB-TTTHHHHCCHHHHHHHHHHHHHHHHHHT---T--HHHHHHHHHH
T ss_pred CCccEEEEEECCcEEEECCccHHHHHHHHHHHHHHHHHHHHHHHHhhCcccccCCHHHHHHHHhc
Confidence 88899999999999999999999 56788999999999999999999899999999999764
|
It functions non-catalytically to target the protein towards replication foci. This allows the DNMT1 protein to methylate the correct residues. This domain targets DMAP1 and HDAC2 to the replication foci during the S phase of mitosis. They are thought to have some importance in conversion of critical histone lysine moieties []. A structure exists for the human cytosine specific DNA methyltransferase replication foci domain. ; PDB: 3AV6_A 3AV5_A 3AV4_A 3EPZ_B. |
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PF07669 Eco57I: Eco57I restriction-modification methylase; InterPro: IPR011639 This entry contains restriction modification methylases, which in the case of endonuclease Eco57I is found adjacent to the DNA cleavage domain, which recognises asymmetric DNA sequence 5'-CTGAAG [, ] | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 61.8 bits (149), Expect = 9e-10
Identities = 86/670 (12%), Positives = 185/670 (27%), Gaps = 207/670 (30%)
Query: 126 KYIREQMLKVFCSYEVEPSENDLLDHMPISREAAERDKDLANSKFLLSFMANHPETNTFH 185
K +++ + E+ DH+ +S++A + L + + E
Sbjct: 36 KDVQDMPKSILSKEEI--------DHIIMSKDAVSG------TLRLFWTLLSKQE-EMVQ 80
Query: 186 EDVRTTEKP--KVIVDWNEDEDSERVDKDENYFAVCAICDDGGDVTFCDGRCLRSFHAT- 242
+ V + K ++ + E + Y + D + D + ++ +
Sbjct: 81 KFVEEVLRINYKFLMSPIKTEQRQPSMMTRMY-------IEQRDRLYNDNQVFAKYNVSR 133
Query: 243 ---ITAGKNALCQSLGYTQAQIDAVPNFLCQNCVYQEHQCFACGMLGSSDKSS------- 292
+ AL + + N L + G+LGS K+
Sbjct: 134 LQPYLKLRQALLE--------LRPAKNVL----ID--------GVLGSG-KTWVALDVCL 172
Query: 293 ---SQEVFPC-VS-ATCGQFYHPECVSKLLHPDNESLAEELRERIAAGESFTCPVHKCFV 347
Q + PE V ++L + L ++ + + +
Sbjct: 173 SYKVQCKMDFKIFWLNLKNCNSPETVLEML----QKLLYQIDPNWTSRSDHSSNI----- 223
Query: 348 CQQSEDMNVEDLQLAICRRCPKAYHRKCLPTEITFSDADENNFQRAWV----DLLPNNRI 403
+ + +Q + R + CL + + Q A +L + +I
Sbjct: 224 -----KLRIHSIQAELRRLLKSKPYENCL---LVLLNV-----QNAKAWNAFNL--SCKI 268
Query: 404 LIYCLEHKIISELKTPARDHLKFPGVEGKRKKEDLELLLTEEKDVASKRNIVSESFVADK 463
L+ ++ L H+ + + LT ++ +S +
Sbjct: 269 LLTTRFKQVTDFLSAATTTHISL---------DHHSMTLTPDE---------VKSLLLKY 310
Query: 464 TVVKKLKL-AEVYSG-----ADVGMSNSEIKKRWPRQDVHSLKKPNITDTGRKSLKDIAD 517
+ L EV + + + S + W K N L I +
Sbjct: 311 LDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDN-----WKHVNC-----DKLTTIIE 360
Query: 518 KSKPSLRKDSTLLKSR--SFVVKPGHRNIDGSKMKNSISDRRRMKKVNISQPSVDAEMEK 575
S L + + V P +I P+
Sbjct: 361 SSLNVL--EPAEYRKMFDRLSVFP--------------------PSAHI--PT------- 389
Query: 576 ELLALIKDSTSSFNEEEFMKSHIVPITHAHHSKHLLEKSITLGLVEGSVKAVRAALEML- 634
LL+LI + + L + S LVE K ++ +
Sbjct: 390 ILLSLIWFDVIKSDVMVVVN-------------KLHKYS----LVEKQPKESTISIPSIY 432
Query: 635 -DGGCDIEDAKAVCPPEILCQIFQWKRKLDVY--LAPFLHGMRYTSFGRHFTKVEKLKEI 691
+ +E+ A+ + + + D + P+L Y+ G H +E + +
Sbjct: 433 LELKVKLENEYAL--HRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERM 490
Query: 692 VDRLHWYVRSGDTIVDFCCGANDFSCMMKVKLEQMGKSCS-----------FRNY-DLIQ 739
+ +DF F ++ K+ + + + Y I
Sbjct: 491 TLFRMVF-------LDF-----RF---LEQKIRHDSTAWNASGSILNTLQQLKFYKPYIC 535
Query: 740 PKNDFSFEKR 749
ND +E+
Sbjct: 536 -DNDPKYERL 544
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 876 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.35 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.0 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.85 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.84 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.83 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.82 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.67 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.6 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.54 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.52 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.41 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.38 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.38 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.36 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.35 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.29 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.21 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.18 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.17 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.1 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.07 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.05 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.05 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.99 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.97 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 97.88 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.87 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 97.87 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 97.84 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.77 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.7 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.69 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 97.67 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 97.6 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.57 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.56 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.55 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 97.33 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.3 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 97.29 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.29 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 97.27 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.26 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.25 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 97.25 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 97.12 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 97.06 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.02 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.0 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 96.97 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.93 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 96.93 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 96.91 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.91 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 96.9 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 96.88 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 96.82 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 96.78 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 96.75 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 96.73 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 96.72 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.59 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.49 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 96.45 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 96.43 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.42 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.41 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 96.29 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 96.26 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.17 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 96.11 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 96.09 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 96.06 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 96.04 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 96.02 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 95.98 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 95.93 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 95.89 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 95.89 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 95.81 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 95.76 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 95.7 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 95.68 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 95.63 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.63 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 95.57 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 95.24 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.19 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 94.54 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 94.47 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 94.22 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 94.19 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 94.06 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 94.03 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 93.99 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 93.64 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 92.78 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 92.56 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 92.36 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 92.23 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 91.98 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 91.54 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 91.48 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 91.37 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 91.2 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 90.97 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 90.7 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 90.5 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 89.88 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 89.57 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 89.4 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 89.35 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 89.29 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 89.14 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 89.11 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 87.85 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 87.45 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 87.03 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 86.47 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 86.25 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 86.07 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 86.03 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 85.91 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 85.34 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 84.83 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 84.28 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 83.96 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 83.95 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 83.67 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 82.73 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 82.35 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 82.28 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 81.91 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 81.32 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 81.11 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 80.33 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 80.06 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 80.02 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.35 E-value=7.8e-13 Score=122.25 Aligned_cols=103 Identities=24% Similarity=0.683 Sum_probs=78.7
Q ss_pred cCCCCccccccCCCCce---eecCcccccccccccccCccccccccCCcccccCCCCceecccccccCcccccccccCCC
Q 002824 212 DENYFAVCAICDDGGDV---TFCDGRCLRSFHATITAGKNALCQSLGYTQAQIDAVPNFLCQNCVYQEHQCFACGMLGSS 288 (876)
Q Consensus 212 dd~~d~VCaICe~gGeL---L~CdG~C~RsFH~~Cl~g~~s~C~sLGlT~~ev~~~~~W~C~eC~~gqHqCfiCgklGss 288 (876)
...++++|.+|+++|++ |+|+ .|.++||+.|+ +++..++ +.+.|+|++|. .|.+|++.+.
T Consensus 3 ~~~~~~~C~~C~~~g~~~~ll~C~-~C~~~~H~~Cl----------~~~~~~~-~~~~W~C~~C~----~C~~C~~~~~- 65 (111)
T 2ysm_A 3 SGSSGANCAVCDSPGDLLDQFFCT-TCGQHYHGMCL----------DIAVTPL-KRAGWQCPECK----VCQNCKQSGE- 65 (111)
T ss_dssp CCCCCSCBTTTCCCCCTTTSEECS-SSCCEECTTTT----------TCCCCTT-TSTTCCCTTTC----CCTTTCCCSC-
T ss_pred CCCCCCCCcCCCCCCCCcCCeECC-CCCCCcChHHh----------CCccccc-cccCccCCcCC----cccccCccCC-
Confidence 34578999999999986 9999 59999999974 3332222 35799999998 6999998763
Q ss_pred CCCCCCceeccCCCccCCCCccccccccCCCCchhHHHHHHHHhhcCCceecCCcccccCcCCc
Q 002824 289 DKSSSQEVFPCVSATCGQFYHPECVSKLLHPDNESLAEELRERIAAGESFTCPVHKCFVCQQSE 352 (876)
Q Consensus 289 d~ss~~eV~kCsv~~CGkfYH~~CL~~~~~p~~e~~~~eL~krI~~g~~F~CPlH~C~~C~~se 352 (876)
...++.| ..|++.||..|+.+.+.. +. ...|.|| .|..|..+.
T Consensus 66 ----~~~ll~C--d~C~~~yH~~Cl~ppl~~------------~P-~g~W~C~--~C~~c~~g~ 108 (111)
T 2ysm_A 66 ----DSKMLVC--DTCDKGYHTFCLQPVMKS------------VP-TNGWKCK--NCRICISGP 108 (111)
T ss_dssp ----CTTEEEC--SSSCCEEEGGGSSSCCSS------------CC-SSCCCCH--HHHCCSCSC
T ss_pred ----CCCeeEC--CCCCcHHhHHhcCCcccc------------CC-CCCcCCc--CCcCcCCCC
Confidence 3579999 799999999999865421 11 2579998 677777643
|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 876 | |||
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.43 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.25 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 97.35 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 97.3 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.27 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.26 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 97.2 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 97.15 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.08 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.01 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.93 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 96.86 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 96.83 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.13 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.08 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 96.07 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 95.68 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 95.66 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 95.53 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 95.4 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 92.21 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 92.14 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 91.97 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 91.52 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 90.36 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 88.16 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 88.06 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 87.7 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 87.34 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 84.74 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 80.81 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.43 E-value=7e-08 Score=78.76 Aligned_cols=50 Identities=28% Similarity=0.758 Sum_probs=38.8
Q ss_pred CCCCccccccCCCCceeecCcccccccccccccCccccccccCCcccccCCCCceecccccc
Q 002824 213 ENYFAVCAICDDGGDVTFCDGRCLRSFHATITAGKNALCQSLGYTQAQIDAVPNFLCQNCVY 274 (876)
Q Consensus 213 d~~d~VCaICe~gGeLL~CdG~C~RsFH~~Cl~g~~s~C~sLGlT~~ev~~~~~W~C~eC~~ 274 (876)
+.++++|.+|.++|+||.|+ .|.++||..|+. ..++ .+ +.+.|+|+.|..
T Consensus 6 d~~~~~C~~C~~~g~lv~Cd-~C~~~~H~~C~~--------~~~~--~~-~~~~W~C~~C~~ 55 (61)
T d1mm2a_ 6 DHHMEFCRVCKDGGELLCCD-TCPSSYHIHCLN--------PPLP--EI-PNGEWLCPRCTC 55 (61)
T ss_dssp CSSCSSCTTTCCCSSCBCCS-SSCCCBCSSSSS--------SCCS--SC-CSSCCCCTTTTT
T ss_pred cCCcCCCcCCCCCCeEEEeC-CCCccCchhhcC--------CCcC--cC-CCCcEECCCCcC
Confidence 45567999999999999999 599999999753 2232 22 357899999974
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|