Citrus Sinensis ID: 002868

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870--

MPRITTGDIRFVICIQRQLKHLWETLCSDSASSVAEFDEGKRSCRRRLAGHNKRRRKTHPDNVVNGGSLNDERSSSYLLISLLRILSNMHSNNSDQTKDQDLLSHLFRNLAGVVGTSNVRNLSGLLQGSQGLLNAGPSNGNVEKVPDLVSTGPEPSRPSTSACMTDNRIGFSEPMRSVGQCGTVPASDLLQKKISTNDAHSGRVQALSASQSIEMFPSRSSFSAKANEPEATFGRSKMSNIDLNNVYDDSQERVEHLELSHAPVNPGPVSLYSPLWLHPGSNKSSPPQASANSDSTSSQSQSSSSGEAQSRTDRIVFKLFGKDPNDFPLVLRRQILDWLSHSPTDIESYIRPGCIVLTIYLRLGKPTWEELCCDLGSSLRRLLEGSDDLFWRTGWLYARVQHSVAFIYNGQVVLDTPLLLKSHKSCRISSIKPIAVPVSERVKFVVKGFNLSRSTTRLLCAIEGSYLVQETCYDLMGGADTVNENDELQCLSFPCSIPNVFGRGFIEVEDHGLSSSFVPFIVAEQEVCSEICMLESAIEAAEISDDFQKIAEKTEVKNQALDFLHEMGWLLHRSHLKFRVGHLHPNFYFFPFKRFKWLLEFSMEHDWCAVVKKLLGILFDGTVDTGDHTSSELAILEMGLLHKAVRRNCRPMVELLLNYAPDNVLDKPGSRQKQLVDRAGSGFIFKPNVIGPAGLTPLHVAACRDDAENVLDALTDDPGSVGIEAWKSAQDSTGLTPNDYASLRAHHSYIHLVQRKINKKSSESGRVILDIPGSIVDWDSKQKPLKGNKSSRVLSLQTEKITTKVMQQQCRLCEQKVAYRNMRSSLVYRPVMLSMVAIAAVCVCVALLFKSSPEVLYIFRPFRWELLKYGSS

ccEEEEccEEEEEEEEcccccHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHccccccccccccccEEEEEEECccHHHHHHHHHcHHHHHHHHHHccccccccccEEEEEEccEEEEEEccEEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEccccccccEEEEEEcccEEEEEEEccccccccccccccccEEEEccccccccccccEEEEEccccccccCEEEEccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccHHcccccccccccccccccccccHHHHHcccccHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccc

*PRITTGDIRFVICIQRQLKHLWETLCSDSASSVAEFDEGKRSC********************************YLLISLLRILS**************LLSHLFRNLAGVVG****RN************************************************************************************************************************************************************************************************RIVFKLFGKDPNDFPLVLRRQILDWLSHSPTDIESYIRPGCIVLTIYLRLGKPTWEELCCDLGSSLRRLLEGSDDLFWRTGWLYARVQHSVAFIYNGQVVLDTPLLLKSHKSCRISSIKPIAVPVSERVKFVVKGFNLSRSTTRLLCAIEGSYLVQETCYDLMGGADTVNENDELQCLSFPCSIPNVFGRGFIEVEDHGLSSSFVPFIVAEQEVCSEICMLESAIEAAEISDDFQKIAEKTEVKNQALDFLHEMGWLLHRSHLKFRVGHLHPNFYFFPFKRFKWLLEFSMEHDWCAVVKKLLGILFDGTVDTGDHTSSELAILEMGLLHKAVRRNCRPMVELLLNYAPDNVLDKPGSRQKQLVDRAGSGFIFKPNVIGPAGLTPLHVAACRDDAENVLDALTDDPGSVGIEAWKSAQDSTGLTPNDYASLRAHHSYIHLVQRKINK******RVILDIPGSIV*********************TEKITTKVMQQQCRLCEQKVAYRNMRSSLVYRPVMLSMVAIAAVCVCVALLFKSSPEVLYIFRPFRWELLKYG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Squamosa promoter-binding-like protein 1	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence.	probable	Q9SMX9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXI, chain A
Confidence level:very confident
Coverage over the Query: 595-670,681-761
View the alignment between query and template
View the model in PyMOL

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL

Template: 1OY3, chain D
Confidence level:confident
Coverage over the Query: 595-762
View the alignment between query and template
View the model in PyMOL