Citrus Sinensis ID: 002871


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870--
MEQQSGDSVSGHSKGSSNIPSLTIPKKVGSGAWGISFGTEANNASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRPGGARRNLMQQLNQELEQDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGSPPPYSERSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFTERGRTRRVENCGSQVDSKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPDGSYSGDSLESLNGYPDEKPEKI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccEEEcccccccccccEEEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEEcccHHHHHHHHHHHccccccccccccEEEEEEHHHHcHHHHHHHHccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccccccccccccccccccccccEccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccccEEEEEEccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEcccccccEEEEEccHHHHHHHHHHHcccEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHcccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccEEEEcHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEcccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccc
meqqsgdsvsghskgssnipsltipkkvgsgawgisfgteannasndaslfssslpvlpheklnfadsehhdqsvddssptlnkidlenesngplagvetigsllpddendllaglvddfdlrglpsqledleddlfdsgggmelefepheslsigvsklnisdgiagtgiahypisngvgtvagehpygehpsrtlFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQnkplrrrkldihfsipkdnpsekdvnqgtLVVFNldasvsnddLRQIFGAYgevkeiretphkrhhkFIEFYDVRAAEAALRALNRsdingkriklepsrpggarRNLMQQLNQELEQDEArgfrhqvgspvtnsppgtwaqfgspvernplhafskspglgtlspinsnplhafskstglatptpvnsnhlpglasilpphlsntgkiapigkdqgranqtnhmfsnsaslqgaayqhsqsfpeqklsaspgpkspfgesnsnssgvgtlsgpqflwgspppyserssssawptssvghpfsssgqgqgfpygsrhgsfigshhqhhvgsapsgvsldrnfgffpespetsftnpvplggmglsrnnagymmnvggrvgvglplnvtdngspslrmmsfprhgplffgngsysglgttsneaftergrtrrvencgsqvdskkqyqldldkiisgedtrtTLMIKNIPNKYTSKMLLAAIDEnhrgtydflylpidfknkcnvGYAFINMVSPSHIISFYEAfngkkwekfNSEKVASLAYARIQGQAALVTHFqnsslmnedkrcrpivfhsegqetsdQEALLSSNlnifirqpdgsysgdsleslngypdekpeki
meqqsgdsvsghskgssnipsltipkKVGSGAWGISFGTEANNASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRalqnkplrrrKLDIhfsipkdnpsekdvnQGTLVVFNLDASVSNDDLRQIFGAYGevkeiretphkrhhKFIEFYDVRAAEAALRalnrsdingkriklepsrpggarrNLMQQLNQELEQDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGSPPPYSERSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNeaftergrtrrvencgsqvdskkqyqldldkiisgedtrttlmiknipnkYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPdgsysgdsleslngypdekpeki
MEQQSGDSVSGHSKGSSNIPSLTIPKKVGSGAWGISFGTEANNASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVraaeaalralNRSDINGKRIKLEPSRPGGARRnlmqqlnqeleqDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGspppyserssssawpTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFTERGRTRRVENCGSQVDSKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPDGSYSGDSLESLNGYPDEKPEKI
******************************GAWGISF***************************************************************IGSLLPDDENDLLAGLVDDFDLRGL**************************SLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNK*LR*RKLDIHF*************QGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRAL*************************************************************************************************************************************************************************************************************************************************************************************MGLSRNNAGYMMNVGGRVGVGLPLNVT*************RHGPLFFGNGSY********************************YQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLM****RCRPIVF******************NIFI**************************
***************************************************************************************************TIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLN**********************************TLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDI*******************VVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEP*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHS**********************************************
*****************NIPSLTIPKKVGSGAWGISFGTEANNASNDASLFSSSLPVLPHEKLNFAD************PTLNKIDLENESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRPGGARRNLMQQLNQELEQDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSAS*************************************GTLSGPQFLWGS***************************GQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFTER****************KQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPDGSYSGDSLESLNGYPDEKPEKI
*************************************************LFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKI***NESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRP******************EARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGSPPPYSERSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFT****************SKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSE*QE**DQEALLSSN*******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQQSGDSVSGHSKGSSNIPSLTIPKKVGSGAWGISFGTEANNASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAGVETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRPGGARRNLMQQLNQELEQDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGSPPPYSERSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPLGGMGLSRNNAGYMMNVGGRVGVGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFTERGRTRRVENCGSQVDSKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPDGSYSGDSLESLNGYPDEKPEKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query872 2.2.26 [Sep-21-2011]
Q6ZI17848 Protein MEI2-like 2 OS=Or yes no 0.881 0.906 0.582 0.0
Q8VWF5800 Protein MEI2-like 5 OS=Ar yes no 0.889 0.97 0.561 0.0
Q6EQX3811 Protein MEI2-like 5 OS=Or no no 0.891 0.958 0.506 0.0
Q9SVV9759 Protein MEI2-like 3 OS=Ar no no 0.782 0.898 0.542 0.0
Q9SJG8843 Protein MEI2-like 2 OS=Ar no no 0.868 0.897 0.493 0.0
Q64M781001 Protein MEI2-like 4 OS=Or no no 0.854 0.744 0.454 1e-159
Q75M35955 Protein MEI2-like 3 OS=Or no no 0.780 0.713 0.410 1e-134
Q8W4I9915 Protein MEI2-like 1 OS=Ar no no 0.815 0.777 0.395 1e-126
Q9LYN7907 Protein MEI2-like 4 OS=Ar no no 0.819 0.788 0.399 1e-123
P08965750 Meiosis protein mei2 OS=S yes no 0.130 0.152 0.550 3e-36
>sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 Back     alignment and function desciption
 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/831 (58%), Positives = 587/831 (70%), Gaps = 62/831 (7%)

Query: 41  ANNASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAG--V 98
           A N   +ASLFS+SLPVLPHEK+NF DS      +DD+S  L ++D + E         +
Sbjct: 41  ARNGLANASLFSTSLPVLPHEKINFLDSARGTPLMDDASAKLKELDDDPEGKDYKFDFDL 100

Query: 99  ETIGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLED-DLFDSGGGMELEFEPHESLSIGV 157
             I  LLP+ E+DL AG+ ++ +  G  + +E+LE+ D+F SGGGMEL+ +P ES++ G+
Sbjct: 101 RQIDDLLPN-EDDLFAGITNEIEPAGQTNSMEELEEFDVFGSGGGMELDTDPVESITAGL 159

Query: 158 SKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQ 217
              +I+DG+ G G+ H+  SN   TVAGEHPYGEHPSRTLFVRNINSNV+D ELRSLFEQ
Sbjct: 160 GNTSIADGLRGNGVNHFGPSNSASTVAGEHPYGEHPSRTLFVRNINSNVDDTELRSLFEQ 219

Query: 218 YGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDV 277
           YGDIRTLYTA KHRGFVMISY+DIRAAR AMR LQNKPLRRRKLDIHFSIPK+NPS+KD+
Sbjct: 220 YGDIRTLYTATKHRGFVMISYFDIRAARGAMRGLQNKPLRRRKLDIHFSIPKENPSDKDL 279

Query: 278 NQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALN 337
           NQGTLV+FNLD SVSN+++RQIFG YGEVKEIRETP+K+HHKFIEFYDVRAAEAALR+LN
Sbjct: 280 NQGTLVIFNLDPSVSNEEVRQIFGTYGEVKEIRETPNKKHHKFIEFYDVRAAEAALRSLN 339

Query: 338 RSDINGKRIKLEPSRPGGARRNLMQQLNQELEQDEARGFR-HQVGSPVTNSPPGTWAQFG 396
           +S+I GKRIKLEPSRPGG RRNLMQQL  +++QDE R +R   VGSP+ +SPPG WAQ+ 
Sbjct: 340 KSEIAGKRIKLEPSRPGGTRRNLMQQLGHDIDQDEPRSYRIPHVGSPIASSPPGAWAQYS 399

Query: 397 SPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHL- 455
           SP + N L AF+ SP    +SPI                               +PP L 
Sbjct: 400 SPTDNNLLQAFNASPTGNGMSPIG------------------------------MPPSLI 429

Query: 456 SNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNS 515
           SN  KIAPIGKD   + + + +FSN+    GAA+QHS S+ + K             S  
Sbjct: 430 SNAVKIAPIGKDSNWS-KYDKVFSNNNQPHGAAFQHSHSYQDHK-------------SEH 475

Query: 516 NSSGVGTLSGPQFLWGSPPPYSERSSSSAWPTSSVGH--PFSSSGQGQGFPYGSRHGSFI 573
            SS  GTL+GP+FLWGSP PYSE + S  W   ++GH  P ++  QGQG  YG R  S  
Sbjct: 476 MSSSPGTLTGPEFLWGSPKPYSEHAQSPIWRPPAIGHAIPSNTRSQGQGLLYGGRQASLF 535

Query: 574 GSH---HQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVP---LGGMGLSRNNAGYMMNV 627
           GS    H HHVGSAPSG   + +FGF PESPETS+ N V    +G +G  RN  G M+N+
Sbjct: 536 GSQDQLHHHHVGSAPSGAPFESHFGFLPESPETSYMNQVRFGNIGNIGSGRNGTGLMLNM 595

Query: 628 GGRVGV----GLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAFTERGRTR 683
             R  V     L  N++DN S S R +  PR G  F+GN +Y G G+   +   ERGR R
Sbjct: 596 AARASVNPVSALSGNMSDNNSSSFRPILSPRLGQSFYGNPTYQGPGSFGLDNSIERGRNR 655

Query: 684 RVENCGSQVDSKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDF 743
           RV++   Q DSKKQYQLDL+KI  G+DTRTTLMIKNIPNKYTSKMLLAAIDE H+GTYDF
Sbjct: 656 RVDSSVFQADSKKQYQLDLEKIRKGDDTRTTLMIKNIPNKYTSKMLLAAIDEFHKGTYDF 715

Query: 744 LYLPIDFKNKCNVGYAFINMVSPSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAAL 803
            YLPIDFKNKCNVGYAFINM+SP HI+SFY+AFNGKKWEKFNSEKVASLAYARIQG+ AL
Sbjct: 716 FYLPIDFKNKCNVGYAFINMISPVHIVSFYQAFNGKKWEKFNSEKVASLAYARIQGRTAL 775

Query: 804 VTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIFIRQPDGSYS 854
           ++HFQNSSLMNEDKRCRPI+FHS G +  +QE    + + I +   DG+ +
Sbjct: 776 ISHFQNSSLMNEDKRCRPILFHSNGPDAGNQEPFPINGICIHMPLEDGAIA 826




Probable RNA-binding protein that may play a role in growth regulation.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 Back     alignment and function description
>sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 Back     alignment and function description
>sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 Back     alignment and function description
>sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 Back     alignment and function description
>sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=1 SV=1 Back     alignment and function description
>sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query872
359485142842 PREDICTED: protein MEI2-like 2-like [Vit 0.954 0.988 0.787 0.0
449481207846 PREDICTED: protein MEI2-like 2-like [Cuc 0.958 0.988 0.725 0.0
449444985846 PREDICTED: protein MEI2-like 2-like [Cuc 0.958 0.988 0.724 0.0
356567420857 PREDICTED: protein MEI2-like 2-like [Gly 0.971 0.988 0.727 0.0
356526987856 PREDICTED: protein MEI2-like 2-like [Gly 0.970 0.988 0.722 0.0
224066573763 predicted protein [Populus trichocarpa] 0.866 0.990 0.761 0.0
47834689856 AML1 [Medicago truncatula] 0.965 0.983 0.705 0.0
225463378860 PREDICTED: protein MEI2-like 2-like [Vit 0.948 0.961 0.691 0.0
224082554741 predicted protein [Populus trichocarpa] 0.841 0.990 0.796 0.0
255586946779 RNA-binding protein, putative [Ricinus c 0.852 0.953 0.756 0.0
>gi|359485142|ref|XP_002279792.2| PREDICTED: protein MEI2-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1336 bits (3457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/869 (78%), Positives = 738/869 (84%), Gaps = 37/869 (4%)

Query: 1   MEQQSGDSVSGHSKGSSNIPSLTIPKKVGSGAWGISFGTEANNASNDASLFSSSLPVLPH 60
           MEQ +  S+SG  K    IPSL +PKK+GSGAWGI  GT+A + S+D SLFSSSLPVLPH
Sbjct: 1   MEQHAKGSISGPFK----IPSLNVPKKIGSGAWGIPHGTDAYHTSSDVSLFSSSLPVLPH 56

Query: 61  EKLNFADSEHHDQSVDDSSPTLNKIDLENESNGPLAGVE--TIGSLLPDDENDLLAGLVD 118
           EKL+F DSEH   SVDD SP+LNK+  + ES  PL  V+   IGSLLPDDE++LLAG++D
Sbjct: 57  EKLHFNDSEHCGHSVDDGSPSLNKLQQDEESKDPLEDVDLNAIGSLLPDDEDELLAGIMD 116

Query: 119 DFDLRGLPSQLEDLEDDLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISN 178
           DFDL GLP+Q+EDLEDDLF SGGGMEL+F+      IG+SKL++SDG+AG GI HY + N
Sbjct: 117 DFDLSGLPTQVEDLEDDLFGSGGGMELDFD------IGISKLSLSDGVAGNGIGHYGLPN 170

Query: 179 GVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISY 238
           GV TVAGEHPYGEHPSRTLFVRNINSNVED EL++LFEQYGDIRTLYTACKHRGFVMISY
Sbjct: 171 GVATVAGEHPYGEHPSRTLFVRNINSNVEDSELKTLFEQYGDIRTLYTACKHRGFVMISY 230

Query: 239 YDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQ 298
           YDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKD+NQGTLVVFNLDASVSNDDLRQ
Sbjct: 231 YDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDINQGTLVVFNLDASVSNDDLRQ 290

Query: 299 IFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRPGGARR 358
           IFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDI GKRIKLEPSRPGGARR
Sbjct: 291 IFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDIAGKRIKLEPSRPGGARR 350

Query: 359 NLMQQLNQELEQDEARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSP 418
           NLMQQL+QELEQDEAR FRH VGSPVTNSPPG WA F SPVE NPL A+S SPGLG +SP
Sbjct: 351 NLMQQLSQELEQDEARSFRHHVGSPVTNSPPGNWAAF-SPVEHNPLQAYSHSPGLGNISP 409

Query: 419 INSNPLHAFSKSTGLATPTPVNSNHLPGLASILPPHLSNTGKIAPIGKDQGRANQTNHMF 478
           I                    NSNHLPGLASILPPH+SN+ KIAPIGKDQGR N  N +F
Sbjct: 410 I--------------------NSNHLPGLASILPPHISNSVKIAPIGKDQGRVNHVNQVF 449

Query: 479 SNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWGSPPPYSE 538
           +N+   QGAAYQ S S PEQKLSASPGP S  GESNSNSSG+GTLSGPQFLWGSP PYSE
Sbjct: 450 TNAKPTQGAAYQISHSVPEQKLSASPGPISSLGESNSNSSGIGTLSGPQFLWGSPTPYSE 509

Query: 539 RSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFP 598
           R +SSAWPTSSVGHPF SSGQGQGFPY ++HGSF+GSH  HHVGSAPSGV LDR+FG+FP
Sbjct: 510 RPNSSAWPTSSVGHPFVSSGQGQGFPYSNQHGSFLGSHQHHHVGSAPSGVPLDRHFGYFP 569

Query: 599 ESPETSFTNPVPLGGMGLSRNNAGYMMNVGGR----VGVGLPLNVTDNGSPSLRMMSFPR 654
           ESPETSF +PV  GGMGLSR+N  + MNVG R     GV LP N+T+NG PS RM+S PR
Sbjct: 570 ESPETSFMSPVTFGGMGLSRSNGNFAMNVGARAAINTGVALPGNMTENGLPSFRMLSLPR 629

Query: 655 HGPLFFGNGSYSGLGTTSNEAFTERGRTRRVENCGSQVDSKKQYQLDLDKIISGEDTRTT 714
           HGP F GNG+Y   G TSNE   ERGRTRRVEN G+Q+DSKKQYQLDLDKIISGEDTRTT
Sbjct: 630 HGPPFLGNGTYPVSGVTSNEVLAERGRTRRVENSGNQIDSKKQYQLDLDKIISGEDTRTT 689

Query: 715 LMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIISFYE 774
           LMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHII FYE
Sbjct: 690 LMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIIPFYE 749

Query: 775 AFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQ 834
           AFNGKKWEKFNSEKVASLAYARIQG+AALVTHFQNSSLMNEDKRCRPI+FHSEGQET DQ
Sbjct: 750 AFNGKKWEKFNSEKVASLAYARIQGKAALVTHFQNSSLMNEDKRCRPILFHSEGQETVDQ 809

Query: 835 EALLSSNLNIFIRQPDGSYSGDSLESLNG 863
           E   S NLNI IRQPDGSYSGDSLES  G
Sbjct: 810 EPFASGNLNICIRQPDGSYSGDSLESPKG 838




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449481207|ref|XP_004156114.1| PREDICTED: protein MEI2-like 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444985|ref|XP_004140254.1| PREDICTED: protein MEI2-like 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356567420|ref|XP_003551918.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356526987|ref|XP_003532096.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224066573|ref|XP_002302143.1| predicted protein [Populus trichocarpa] gi|222843869|gb|EEE81416.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|47834689|gb|AAT38998.1| AML1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225463378|ref|XP_002271605.1| PREDICTED: protein MEI2-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224082554|ref|XP_002306739.1| predicted protein [Populus trichocarpa] gi|222856188|gb|EEE93735.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255586946|ref|XP_002534073.1| RNA-binding protein, putative [Ricinus communis] gi|223525900|gb|EEF28317.1| RNA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query872
TAIR|locus:2117706759 ML3 "MEI2-like 3" [Arabidopsis 0.438 0.503 0.573 3.5e-199
TAIR|locus:2045605843 ML2 "MEI2-like 2" [Arabidopsis 0.482 0.499 0.524 3.7e-196
TAIR|locus:2156166915 ML1 "MEI2-like protein 1" [Ara 0.808 0.770 0.400 4.8e-129
TAIR|locus:2013583800 ML5 "MEI2-like protein 5" [Ara 0.514 0.561 0.526 2.7e-116
TAIR|locus:2182885907 ML4 "MEI2-like 4" [Arabidopsis 0.905 0.871 0.375 5.2e-113
TAIR|locus:2090350615 TEL1 "terminal EAR1-like 1" [A 0.122 0.173 0.434 8.6e-50
TAIR|locus:2008530527 TEL2 "terminal EAR1-like 2" [A 0.131 0.218 0.446 1.5e-41
POMBASE|SPAC27D7.03c750 mei2 "RNA-binding protein invo 0.162 0.189 0.514 1e-39
DICTYBASE|DDB_G02792551698 DDB_G0279255 [Dictyostelium di 0.116 0.060 0.460 7.4e-32
GENEDB_PFALCIPARUM|PFF1125c427 PFF1125c "RNA-binding protein 0.167 0.341 0.4 5.8e-25
TAIR|locus:2117706 ML3 "MEI2-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1098 (391.6 bits), Expect = 3.5e-199, Sum P(3) = 3.5e-199
 Identities = 225/392 (57%), Positives = 278/392 (70%)

Query:    43 NASNDASLFSSSLPVLPHEKLNFADSEHHDQSVDDSSPTLNKID--LENESNGPLAGVET 100
             +AS+DASLFSSSLP++ H+ +N  DS H  QSVD+ +  L+     + N  +        
Sbjct:    15 HASSDASLFSSSLPLIQHQNINPRDSYH--QSVDEMASGLDHFSGGIGNMLDD--GDSHP 70

Query:   101 IGSLLPDDENDLLAGLVDDFDLRGLPSQLEDLED-DLFDSGGGMELEFEPHESLSIGVSK 159
             IG++LPDDE +L +GL+DD +L  LP+ L+DLED DLF SGGG+ELE +P++SL+ G S+
Sbjct:    71 IGNMLPDDEEELFSGLMDDLNLSSLPATLDDLEDYDLFGSGGGLELETDPYDSLNKGFSR 130

Query:   160 LNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLELRSLFEQYG 219
             +  +D      +      NGVG++AGEHPYGEHPSRTLFVRNINSNVED EL++LFEQYG
Sbjct:   131 MGFADSNVDNVMPQNIFQNGVGSIAGEHPYGEHPSRTLFVRNINSNVEDSELQALFEQYG 190

Query:   220 DIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQ 279
              IRTLYTACK RGFVM+SY DIRA+R AMRALQ K L++RKLDIHFSIPKDNPSEKDVNQ
Sbjct:   191 HIRTLYTACKQRGFVMVSYNDIRASRAAMRALQGKLLKKRKLDIHFSIPKDNPSEKDVNQ 250

Query:   280 GTLVVFNLDASVSNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVXXXXXXXXXXNRS 339
             GTLVVFNL  SVSN DL  IFG YGE+KEIRETP+KRHHKF+EF+DV          NR+
Sbjct:   251 GTLVVFNLAPSVSNRDLENIFGVYGEIKEIRETPNKRHHKFVEFFDVRSADAALKALNRT 310

Query:   340 DINGKRIKLEPSRPGGARRXXXXXXXXXXXXDEARGFRHQVGSPVTNSPPGTWAQFGSPV 399
             +I GKRIKLE SRPGGARR            D++  + + V SP+ +SP G W    SP+
Sbjct:   311 EIAGKRIKLEHSRPGGARRNMMLQMNPELEQDDSYSYLNHVESPLASSPIGNWRN--SPI 368

Query:   400 ERNPLHAFSKSPGLGTLSPINSNPLHAFSKST 431
             + +PL +FSKSP  G LSP  +     FS  T
Sbjct:   369 D-HPLQSFSKSPIFGNLSPTKNIRYPEFSMKT 399


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0005634 "nucleus" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
TAIR|locus:2045605 ML2 "MEI2-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156166 ML1 "MEI2-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013583 ML5 "MEI2-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182885 ML4 "MEI2-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090350 TEL1 "terminal EAR1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008530 TEL2 "terminal EAR1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC27D7.03c mei2 "RNA-binding protein involved in meiosis Mei2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279255 DDB_G0279255 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFF1125c PFF1125c "RNA-binding protein mei2 homologue, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VWF5AML5_ARATHNo assigned EC number0.56120.88990.97yesno
Q6ZI17OML2_ORYSJNo assigned EC number0.58240.88180.9068yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018912001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (819 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query872
pfam0405997 pfam04059, RRM_2, RNA recognition motif 2 8e-63
cd1253186 cd12531, RRM3_MEI2_like, RNA recognition motif 3 i 5e-62
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 2e-48
cd1227786 cd12277, RRM3_MEI2_EAR1_like, RNA recognition moti 1e-43
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 2e-43
cd12530101 cd12530, RRM3_EAR1_like, RNA recognition motif 3 i 6e-39
cd1253290 cd12532, RRM3_MEI2_fungi, RNA recognition motif 3 3e-37
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 2e-32
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-30
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 3e-27
smart0036073 smart00360, RRM, RNA recognition motif 1e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-15
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-13
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 9e-13
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 2e-12
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-12
smart0036073 smart00360, RRM, RNA recognition motif 2e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-11
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 4e-11
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-10
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 3e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 6e-10
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-09
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 3e-09
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 4e-09
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-08
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-08
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-08
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 3e-08
cd1252671 cd12526, RRM1_EAR1_like, RNA recognition motif 1 i 3e-08
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 3e-08
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 4e-08
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 4e-08
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 4e-08
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 5e-08
cd1252572 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 5e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-08
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-07
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 2e-07
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 2e-07
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-07
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-07
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 3e-07
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 3e-07
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 3e-07
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-07
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 6e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 6e-07
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 7e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-06
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 1e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 3e-06
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 3e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 4e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 4e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 4e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 5e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 5e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-06
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 6e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-06
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 7e-06
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 9e-06
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 1e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-05
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-05
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 1e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-05
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 1e-05
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 1e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 2e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-05
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-05
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 3e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 3e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 3e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 3e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 3e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 3e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 4e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 4e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 4e-05
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 4e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 4e-05
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-05
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 5e-05
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 5e-05
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 6e-05
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 6e-05
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 7e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 7e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 8e-05
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 9e-05
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 9e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 9e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 1e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-04
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 1e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-04
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 2e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-04
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-04
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 3e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 3e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 3e-04
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-04
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 4e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 4e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 4e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 4e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 5e-04
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 5e-04
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 5e-04
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 5e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 5e-04
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 6e-04
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 6e-04
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 7e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 7e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 7e-04
cd1228893 cd12288, RRM_La_like_plant, RNA recognition motif 7e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 7e-04
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 8e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 8e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 9e-04
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 9e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.001
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.001
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.001
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 0.001
cd1245588 cd12455, RRM_like_Smg4_UPF3, RNA recognition motif 0.001
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 0.001
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 0.001
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 0.001
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.001
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.001
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 0.001
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 0.001
smart0036073 smart00360, RRM, RNA recognition motif 0.002
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.002
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.002
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.002
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.002
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 0.002
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.002
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 0.002
cd1241980 cd12419, RRM_Ssp2_like, RNA recognition motif in y 0.002
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 0.002
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 0.002
cd1276673 cd12766, RRM2_SRSF6, RNA recognition motif 2 found 0.002
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.002
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.002
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 0.002
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.002
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.002
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.003
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.003
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.003
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.003
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 0.003
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.003
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.003
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 0.003
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.003
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.003
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 0.003
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.003
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.003
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 0.003
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.004
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.004
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 0.004
>gnl|CDD|112856 pfam04059, RRM_2, RNA recognition motif 2 Back     alignment and domain information
 Score =  205 bits (524), Expect = 8e-63
 Identities = 82/97 (84%), Positives = 88/97 (90%)

Query: 712 RTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVSPSHIIS 771
           RTTLMIKNIPNKYT KMLLAAIDE ++GTYDFLYLPIDFKNKCNVGYAFINM+ P  II 
Sbjct: 1   RTTLMIKNIPNKYTQKMLLAAIDEKNKGTYDFLYLPIDFKNKCNVGYAFINMIEPQSIIP 60

Query: 772 FYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQ 808
           F +AFNGKKWEKFNSEKVASLAYARIQG+ AL+ HFQ
Sbjct: 61  FGKAFNGKKWEKFNSEKVASLAYARIQGKDALIAHFQ 97


Length = 97

>gnl|CDD|240975 cd12531, RRM3_MEI2_like, RNA recognition motif 3 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240723 cd12277, RRM3_MEI2_EAR1_like, RNA recognition motif 3 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240974 cd12530, RRM3_EAR1_like, RNA recognition motif 3 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240976 cd12532, RRM3_MEI2_fungi, RNA recognition motif 3 in fungal Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240970 cd12526, RRM1_EAR1_like, RNA recognition motif 1 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal Mei2-like proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240734 cd12288, RRM_La_like_plant, RNA recognition motif in plant proteins related to the La autoantigen Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240901 cd12455, RRM_like_Smg4_UPF3, RNA recognition motif-like Smg4_UPF3 domain in yeast up-frameshift suppressor 3 (Upf3p), Caenorhabditis elegans SMG-4, their human orthologs Upf3A and Upf3B, and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240865 cd12419, RRM_Ssp2_like, RNA recognition motif in yeast sporulation-specific protein 2 (Ssp2) and similar protein Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241210 cd12766, RRM2_SRSF6, RNA recognition motif 2 found in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 872
KOG4660549 consensus Protein Mei2, essential for commitment t 100.0
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 100.0
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.96
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.96
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.94
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.92
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.92
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.92
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.92
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.9
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.9
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.89
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.89
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.89
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.88
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.88
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.88
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.86
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.84
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.83
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.82
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.82
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.81
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.77
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.76
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.75
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.74
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.73
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.71
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.7
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.63
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.63
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.62
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.6
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.52
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.49
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.46
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.43
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.42
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.41
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.36
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.36
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.33
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.28
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.27
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.23
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.21
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.19
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.18
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.17
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.16
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.16
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.15
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.14
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.13
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.12
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.12
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.11
KOG0122270 consensus Translation initiation factor 3, subunit 99.1
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.1
PLN03120260 nucleic acid binding protein; Provisional 99.09
KOG0122270 consensus Translation initiation factor 3, subunit 99.09
PLN03120260 nucleic acid binding protein; Provisional 99.09
KOG4660549 consensus Protein Mei2, essential for commitment t 99.06
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.05
smart0036272 RRM_2 RNA recognition motif. 99.05
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.05
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.03
PLN03213759 repressor of silencing 3; Provisional 99.01
KOG4207256 consensus Predicted splicing factor, SR protein su 99.01
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.01
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.01
PLN03213 759 repressor of silencing 3; Provisional 98.99
smart0036272 RRM_2 RNA recognition motif. 98.98
KOG4207256 consensus Predicted splicing factor, SR protein su 98.98
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.97
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.97
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.96
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.94
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.92
PLN03121243 nucleic acid binding protein; Provisional 98.91
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.89
PLN03121243 nucleic acid binding protein; Provisional 98.89
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.87
smart0036071 RRM RNA recognition motif. 98.87
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.87
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.86
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.86
smart0036071 RRM RNA recognition motif. 98.83
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.81
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.77
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.76
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.74
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.69
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.67
smart0036170 RRM_1 RNA recognition motif. 98.64
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.63
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.63
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.63
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.61
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.61
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.6
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.57
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.57
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.57
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.47
smart0036170 RRM_1 RNA recognition motif. 98.43
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.4
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.4
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.37
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.35
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.33
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.32
KOG4210285 consensus Nuclear localization sequence binding pr 98.32
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 98.32
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.19
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.19
KOG0226290 consensus RNA-binding proteins [General function p 98.18
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.17
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 98.12
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.04
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.04
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.94
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.89
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.88
KOG0151877 consensus Predicted splicing regulator, contains R 97.81
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.77
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.74
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.7
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.7
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 97.66
KOG0151 877 consensus Predicted splicing regulator, contains R 97.63
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.56
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.56
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.56
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.44
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.41
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.36
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.33
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.27
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.22
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.18
KOG0226290 consensus RNA-binding proteins [General function p 97.17
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.16
KOG4210285 consensus Nuclear localization sequence binding pr 96.78
KOG1855484 consensus Predicted RNA-binding protein [General f 96.67
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.65
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 96.49
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.47
KOG1295 376 consensus Nonsense-mediated decay protein Upf3 [RN 96.32
KOG1855484 consensus Predicted RNA-binding protein [General f 96.26
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.15
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.11
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.11
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.96
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.96
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 95.84
KOG1995351 consensus Conserved Zn-finger protein [General fun 95.62
KOG3152278 consensus TBP-binding protein, activator of basal 95.57
KOG3152278 consensus TBP-binding protein, activator of basal 95.36
KOG2314698 consensus Translation initiation factor 3, subunit 95.35
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.32
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.24
KOG1995351 consensus Conserved Zn-finger protein [General fun 95.17
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.12
KOG0112975 consensus Large RNA-binding protein (RRM superfami 94.92
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 94.85
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.81
KOG0129520 consensus Predicted RNA-binding protein (RRM super 94.2
KOG2314698 consensus Translation initiation factor 3, subunit 94.16
KOG1996378 consensus mRNA splicing factor [RNA processing and 93.97
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 93.13
PF15023166 DUF4523: Protein of unknown function (DUF4523) 92.7
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 91.65
PF15023166 DUF4523: Protein of unknown function (DUF4523) 91.27
KOG2591684 consensus c-Mpl binding protein, contains La domai 91.2
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 91.07
KOG1996378 consensus mRNA splicing factor [RNA processing and 90.88
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 90.58
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 90.13
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 89.85
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 89.03
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 88.98
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 88.79
KOG2591684 consensus c-Mpl binding protein, contains La domai 88.14
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 87.93
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 87.8
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 86.54
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 83.6
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 83.59
KOG2068327 consensus MOT2 transcription factor [Transcription 82.76
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=1.3e-73  Score=634.69  Aligned_cols=512  Identities=53%  Similarity=0.770  Sum_probs=377.6

Q ss_pred             cc-cccCCCCcEEEEecChhhHHHhhhhhhcccCCcCCCccccccCCCCCcccCCCCCCCCCCcEEEEcCCCCCCCHHHH
Q 002871          133 ED-DLFDSGGGMELEFEPHESLSIGVSKLNISDGIAGTGIAHYPISNGVGTVAGEHPYGEHPSRTLFVRNINSNVEDLEL  211 (872)
Q Consensus       133 ee-dlf~s~Ggv~V~~d~~esa~~a~~k~~~~~~~~~ngv~~~~l~n~~~~~~g~~~~~e~~srtLfV~NLP~~vteeeL  211 (872)
                      ++ ++|...|+++++.+.-..+..   +         +     ...+..+.+..++|..+  .++ +|         .+|
T Consensus         2 ~d~~lf~~~G~~el~~~~~~~~~~---~---------~-----~~~n~~~~~~~~~P~~~--s~~-~~---------~~l   52 (549)
T KOG4660|consen    2 EDCDLFSSGGGMELDADSFDNLSV---R---------N-----SDRNSAGFVFPEHPPGE--SRT-FV---------SEL   52 (549)
T ss_pred             CccccccCCCCCCcccccccchhh---c---------c-----cccCCCccccCCCCCCC--CCC-Ch---------hhH
Confidence            55 899999999886654333222   1         0     11244556778888877  666 77         788


Q ss_pred             HHHhhccCCeEEEEeCCCcccEEEEEeCCHHHHHHHHHHhcCcccccceeeeeecCCCCCCCCccccccceeeeccCCcc
Q 002871          212 RSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASV  291 (872)
Q Consensus       212 r~lFs~fG~I~~v~~~~ksrG~AFVeF~d~e~A~~Ai~~Lng~~l~gr~L~V~~a~pk~~~~~~~~~~~tLfV~NLp~~~  291 (872)
                      ..+|++|+                                  +.+           +++.+.+++.++++|+|.|||.++
T Consensus        53 ~a~f~~~~----------------------------------~p~-----------~~~np~~~~~~~~~L~v~nl~~~V   87 (549)
T KOG4660|consen   53 SALFEPFN----------------------------------KPL-----------RPDNPSEKDMNQGTLVVFNLPRSV   87 (549)
T ss_pred             HhhhhccC----------------------------------CCC-----------CcCCCCcccCccceEEEEecCCcC
Confidence            99999981                                  111           115667778899999999999999


Q ss_pred             chhhHhhhhcccCCeEEEEeCCCCccEEEEEECCHHHHHHHHHHhCCceeCCcEEEEEecCCCcccchhhhcCChhccHH
Q 002871          292 SNDDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRPGGARRNLMQQLNQELEQD  371 (872)
Q Consensus       292 TeedL~e~Fs~fG~V~~vri~~~skGfaFVeF~~~e~A~kAl~~LnG~~l~Gr~L~V~~s~p~~~r~~~~~ql~~~~tq~  371 (872)
                      ++++|+++|+.||+|+.|+.++..+|.+||+|.|+.+|++|+++|++.++.|++|+    +|++.++..+-+..      
T Consensus        88 sn~~L~~~f~~yGeir~ir~t~~~~~~~~v~FyDvR~A~~Alk~l~~~~~~~~~~k----~~~~~~~~~~~~~~------  157 (549)
T KOG4660|consen   88 SNDTLLRIFGAYGEIREIRETPNKRGIVFVEFYDVRDAERALKALNRREIAGKRIK----RPGGARRAMGLQSG------  157 (549)
T ss_pred             CHHHHHHHHHhhcchhhhhcccccCceEEEEEeehHhHHHHHHHHHHHHhhhhhhc----CCCcccccchhccc------
Confidence            99999999999999999999999999999999999999999999999999999998    77777776554443      


Q ss_pred             HHHHhhhccCCCCCCCCCCCccccCCCcccCCCCCCCCCCCCCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCcccC
Q 002871          372 EARGFRHQVGSPVTNSPPGTWAQFGSPVERNPLHAFSKSPGLGTLSPINSNPLHAFSKSTGLATPTPVNSNHLPGLASIL  451 (872)
Q Consensus       372 ~l~~~f~~~Gsp~~~spp~~~s~~gsp~~~~~m~~~s~s~g~g~v~p~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~  451 (872)
                        ..+..++++|+++++|+.|.               +...||.|.|....-+..+                        
T Consensus       158 --~~~~~~~~~p~a~s~pgg~~---------------~~~~~g~l~P~~s~~~~~~------------------------  196 (549)
T KOG4660|consen  158 --TSFLNHFGSPLANSPPGGWP---------------RGQLFGMLSPTRSSILLEH------------------------  196 (549)
T ss_pred             --chhhhhccchhhcCCCCCCc---------------CCcceeeeccchhhhhhhc------------------------
Confidence              56778999999999999987               3455666776532111111                        


Q ss_pred             CCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCCCCCCCCCCCCCCCCCCCCCCCcccCC
Q 002871          452 PPHLSNTGKIAPIGKDQGRANQTNHMFSNSASLQGAAYQHSQSFPEQKLSASPGPKSPFGESNSNSSGVGTLSGPQFLWG  531 (872)
Q Consensus       452 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~  531 (872)
                         +++. -....+...+...  ++.|.+  +.    ..-+|.++|...          |..+++..++.+++++--+|+
T Consensus       197 ---~~~~-~~~~~~~~~~~~~--hq~~~~--~~----~~~s~a~~~~~~----------G~~~s~~~~v~t~S~~~g~~n  254 (549)
T KOG4660|consen  197 ---ISSV-DGSSPGRETPLLN--HQRFVE--FA----DNRSYAFSEPRG----------GFLISNSSGVITFSGPGGVWN  254 (549)
T ss_pred             ---chhc-cCccccccccchh--hhhhhh--hc----cccchhhcccCC----------ceecCCCCceEEecCCCcccC
Confidence               1110 0000011122222  233322  11    123446666521          666667778888888744441


Q ss_pred             CCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCCccccccCCCCCCCCCcCCCCCCC
Q 002871          532 SPPPYSERSSSSAWPTSSVGHPFSSSGQGQGFPYGSRHGSFIGSHHQHHVGSAPSGVSLDRNFGFFPESPETSFTNPVPL  611 (872)
Q Consensus       532 ~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gsap~~~~~~~~~~~~~~s~~~~~~~~~~~  611 (872)
                                           ++.+..+         .-.....++|||||+||+..+                  ....
T Consensus       255 ---------------------~~~~~r~---------~~~~~~~~~~~hi~~~Ps~~~------------------l~~~  286 (549)
T KOG4660|consen  255 ---------------------PFPSRRQ---------RQNSSSSHYEHHIGSAPSMHH------------------LLSR  286 (549)
T ss_pred             ---------------------Ccccccc---------ccccCcccccCccCCCccccc------------------cccc
Confidence                                 1211111         111223457899999997222                  1122


Q ss_pred             CCCCCCCCCCCcccccC--Cccc-cCCCCccCCCCCCCccccCCCCCCCcccCCCCCCCCCCCCCccc---ccccccccc
Q 002871          612 GGMGLSRNNAGYMMNVG--GRVG-VGLPLNVTDNGSPSLRMMSFPRHGPLFFGNGSYSGLGTTSNEAF---TERGRTRRV  685 (872)
Q Consensus       612 ~~~g~~~~~g~~~~~~~--~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~g~~~~~~~~~~~~~---~~r~r~rr~  685 (872)
                      +++++.+..|++.++-.  +..| ....+++++..+.++++.+.+++.. .|. ++.  ...+..+..   .+..+.||.
T Consensus       287 ~~~~f~~~s~~~~~~~~~~~n~g~~~~t~~~~e~~s~n~~~e~~~rv~~-~f~-~~~--~~~~~~~~~~~~~~~~~~~Rt  362 (549)
T KOG4660|consen  287 ISVGFNGGSGALEMNSNGQANQGFLTKTGNVTEFNSKNVGMESSPRVPK-NFE-GRR--SYTSQNDYPVELILNYRDRRT  362 (549)
T ss_pred             CccccCCCCCCccccccccCCCCccccCcccccccCCCccccccCCCCc-ccc-ccc--ccccccccccccccccccchh
Confidence            33444444444322211  1222 2356778888899999999999887 672 332  223334444   347777888


Q ss_pred             ccCCCCcccccccccChhhhhcCCCcceeEEeecCCCCCCHHHHHHHHhhcCCceeeEEEeeecccccceeEEEEEeccC
Q 002871          686 ENCGSQVDSKKQYQLDLDKIISGEDTRTTLMIKNIPNKYTSKMLLAAIDENHRGTYDFLYLPIDFKNKCNVGYAFINMVS  765 (872)
Q Consensus       686 ~~~~~~~~~~~~~~~~~~~i~~g~d~rTTvMirNIPnk~t~~~L~~~id~~~~g~ydf~Ylp~df~~~~n~gyaFinf~~  765 (872)
                      +....+.+ ++++.+|+.+|.+|++.|||+||||||||||++||++. ||.++|+|||+||||||+|+||||||||||++
T Consensus       363 t~~i~ni~-n~~~~~dl~~Ildge~~rtt~~iknipNK~T~~ml~~~-d~~~~gtYDFlYLPiDF~nkcNvGYAFINm~s  440 (549)
T KOG4660|consen  363 TVMIKNIP-NKYGQLDLLRILDGECPRTTLMIKNIPNKYTSKMLLAA-DEKNKGTYDFLYLPIDFKNKCNVGYAFINMTS  440 (549)
T ss_pred             hhhhhccc-cchhHHHHHHHHhCcCchhhhHhhccCchhhHHhhhhh-hccccCccceEEeccccccccccceeEEeecC
Confidence            77665554 89999999999999999999999999999999999999 99999999999999999999999999999999


Q ss_pred             hhHHHHHHHHhcCCcccCCCCccEEEEEeeeccchHHHHHHhccCccccCCCCeeeeEEecCCCCCCcccccCCCCcccc
Q 002871          766 PSHIISFYEAFNGKKWEKFNSEKVASLAYARIQGQAALVTHFQNSSLMNEDKRCRPIVFHSEGQETSDQEALLSSNLNIF  845 (872)
Q Consensus       766 ~~~~~~f~~~f~g~~w~~~~s~k~~~v~~A~iQG~~~l~~~~~~s~~~~~~~~~~P~~f~~~~~~~~~~~~~~~~~~~~~  845 (872)
                      |++|++||++|||++|++|+|+|||+|+|||||||++|++|||||++|||++.|+|++|++  ++.|.+|++|... +++
T Consensus       441 p~ai~~F~kAFnGk~W~~FnS~Kia~itYArIQGk~~Li~hFqnS~lm~E~e~y~Pvvf~p--p~dg~~~~~p~~~-~~~  517 (549)
T KOG4660|consen  441 PEAIIRFYKAFNGKKWEKFNSEKIASITYARIQGKEALIEHFQNSSLMCEDEAYRPVVFSP--PEDGREEPEPVKL-NQD  517 (549)
T ss_pred             HHHHHHHHHHHcCCchhhhcceeeeeeehhhhhchHHHHHHhhcccccccchhcCceEecC--cccccccCccccc-ccc
Confidence            9999999999999999999999999999999999999999999999999999999999998  7899999999888 766


Q ss_pred             ccC
Q 002871          846 IRQ  848 (872)
Q Consensus       846 ~~~  848 (872)
                      .+.
T Consensus       518 a~~  520 (549)
T KOG4660|consen  518 AGA  520 (549)
T ss_pred             CCC
Confidence            443



>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1295 consensus Nonsense-mediated decay protein Upf3 [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query872
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 9e-07
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-04
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-04
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 3e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 3e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 6e-04
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 9e-07, Method: Composition-based stats. Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 11/111 (9%) Query: 197 LFVRNINSNVEDLELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPL 256 LFV N+ ++ + E+R LFE+YG ++ K +GF I A A L N PL Sbjct: 25 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIH-KDKGFGFIRLETRTLAEIAKVELDNMPL 83 Query: 257 RRRKLDIHFSIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVK 307 R ++L + F+ + +L V NL VSN+ L + F +G+V+ Sbjct: 84 RGKQLRVRFA----------CHSASLTVRNLPQYVSNELLEEAFSVFGQVE 124
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query872
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-32
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-32
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-07
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-29
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 7e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-28
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-26
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-12
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-26
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-24
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-24
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-23
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-23
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-23
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-22
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-13
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-13
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-22
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-21
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-20
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-20
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-19
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-06
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-19
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 9e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-19
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-18
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-15
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-18
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-16
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-17
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-10
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-10
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-16
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-10
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 5e-16
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-10
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-16
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-11
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 8e-16
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 4e-11
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 9e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-07
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-09
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 5e-14
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-15
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-11
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-09
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-12
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-06
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-15
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-15
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-08
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-14
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-09
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-10
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 5e-14
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-07
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-14
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-08
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 7e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 8e-14
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 9e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 4e-09
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-10
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-13
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 5e-12
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-13
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-10
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-08
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-13
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 5e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 5e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-10
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-13
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-07
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 6e-13
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-11
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-13
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-08
1x5p_A97 Negative elongation factor E; structure genomics, 7e-13
1x5p_A97 Negative elongation factor E; structure genomics, 3e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-11
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 7e-13
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-07
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-13
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 9e-13
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-07
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-12
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-12
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-07
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-12
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-07
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-09
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 9e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 9e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-12
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 9e-10
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 7e-06
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-12
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-08
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-08
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-12
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-07
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 6e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-07
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 7e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 9e-08
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 8e-08
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-11
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-04
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-11
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-07
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-07
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-11
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-08
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-05
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 8e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 9e-11
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-10
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-10
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-06
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-10
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 8e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-10
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-05
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-10
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 9e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 4e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-08
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-10
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-08
1x5o_A114 RNA binding motif, single-stranded interacting pro 8e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 6e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-09
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-09
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-07
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-09
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-06
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 9e-09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-06
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 9e-09
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-08
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 7e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 3e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-04
2div_A99 TRNA selenocysteine associated protein; structural 5e-08
2div_A99 TRNA selenocysteine associated protein; structural 6e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 6e-04
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 7e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-06
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 4e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-07
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 8e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 6e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-05
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 7e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 8e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-05
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 4e-05
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 6e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-05
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 6e-05
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-04
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 1e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 5e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 6e-04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 7e-04
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
 Score =  123 bits (310), Expect = 5e-32
 Identities = 46/226 (20%), Positives = 82/226 (36%), Gaps = 40/226 (17%)

Query: 168 GTGIAHYPISNGVGTVAGEHPYGEHP------SRTLFVRNIN-SNVEDLELRSLFEQYGD 220
           G+   H+  S+G+            P      +  L V N+N   V    L  LF  YGD
Sbjct: 2   GSSHHHHHHSSGLVPRGSHMGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGD 61

Query: 221 IRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFS------IPKDNPSE 274
           ++ +      +   ++   D   A+ AM  L    L  + + I  S      +P++   +
Sbjct: 62  VQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQED 121

Query: 275 KDVNQG-------------------------TLVVFNLDASVSNDDLRQIFGAYGE-VKE 308
           + + +                          TL + N+  SVS +DL+ +F + G  VK 
Sbjct: 122 QGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKG 181

Query: 309 IRETPHKRHHKFIEFYDVRAAEAALRALNRSDI-NGKRIKLEPSRP 353
            +     R    I+   V  A  AL  L+  D+     +++  S+ 
Sbjct: 182 FKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKS 227


>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query872
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.95
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.95
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.95
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.95
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.95
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.95
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.94
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.94
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.94
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.94
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.92
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.78
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.63
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.62
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.61
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.61
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.6
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.59
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.58
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.58
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.58
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.57
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.56
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.55
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.55
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.55
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.55
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.55
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.55
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.54
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.54
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.54
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.54
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.54
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.54
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.53
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.53
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.53
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.53
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.53
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.53
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.52
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.52
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.52
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.52
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.52
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.52
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.52
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.52
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.52
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.52
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.52
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.52
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.52
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.52
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.52
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.52
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.51
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.51
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.51
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.51
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.51
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.51
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.51
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.51
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.51
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.51
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.51
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.51
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.51
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.51
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.51
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.51
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.51
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.51
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.51
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.51
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.51
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.5
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.5
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.5
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.5
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.5
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.5
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.5
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.5
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.5
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.5
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.5
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.5
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.5
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.5
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.5
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.5
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.5
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.5
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.5
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.5
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.49
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.49
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.49
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.49
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.49
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.49
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.49
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.49
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.49
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.49
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.49
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.49
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.49
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.48
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.48
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.48
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.48
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.48
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.48
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.48
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.48
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.48
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.48
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.48
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.48
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.48
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.48
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.48
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.48
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.48
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.48
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.48
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.48
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.48
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.48
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.48
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.48
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.47
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.47
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.47
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.47
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.47
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.47
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.47
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.47
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.47
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.47
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.47
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.47
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.47
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.47
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.47
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.47
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.46
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.46
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.46
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.46
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.46
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.46
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.46
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.46
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.46
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.46
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.46
2div_A99 TRNA selenocysteine associated protein; structural 99.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.46
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.46
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.46
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.46
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.46
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.46
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.46
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.46
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.46
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.46
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.46
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.45
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.45
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.45
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.45
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.45
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.45
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.45
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.45
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.45
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.45
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.45
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.45
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.45
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.45
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.45
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.45
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.45
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.45
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.45
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.45
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.45
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.45
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.45
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.45
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.45
2dis_A109 Unnamed protein product; structural genomics, RRM 99.45
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.45
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.45
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.44
1x5p_A97 Negative elongation factor E; structure genomics, 99.44
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.44
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.44
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.44
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.44
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.44
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.44
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.44
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.44
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.43
1x5p_A97 Negative elongation factor E; structure genomics, 99.43
2div_A99 TRNA selenocysteine associated protein; structural 99.43
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.43
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.43
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.43
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.43
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.43
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.43
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.43
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.43
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.43
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.43
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.43
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.43
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.43
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.42
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.42
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.42
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.42
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.42
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.42
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.42
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.42
2dis_A109 Unnamed protein product; structural genomics, RRM 99.42
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.42
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.41
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.41
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.41
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.41
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.41
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.41
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.41
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.41
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.41
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.41
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.41
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.4
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.4
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.4
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.4
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.4
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.4
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.4
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.4
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.4
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.4
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.39
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.39
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.39
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.39
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.39
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.39
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.39
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.39
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.39
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.38
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.38
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.38
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.38
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.38
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.38
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.38
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.37
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.37
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.37
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.37
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.36
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.36
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.36
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.36
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.36
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.36
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.36
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.35
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.35
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.35
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.34
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.34
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.33
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.33
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.33
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.33
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.01
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.33
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.32
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.32
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.32
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.31
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.31
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.98
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.31
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.31
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.3
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.3
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.3
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.3
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.3
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.3
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.29
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.29
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.29
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.29
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.29
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.28
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.27
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.26
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.25
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.24
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.23
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.23
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.23
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.22
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.22
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.22
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.22
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.22
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.22
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.21
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.2
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.18
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.17
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.13
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.08
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.07
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.06
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.05
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.03
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.03
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.01
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.97
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.95
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.92
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.89
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.88
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.84
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.74
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.69
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 98.57
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.55
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.43
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.42
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.34
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.3
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.07
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.98
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.95
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.63
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.59
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.36
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.79
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.27
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.89
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.82
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.75
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 94.18
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.68
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.5
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.18
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 92.93
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 92.33
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 91.69
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.05
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 89.55
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.96  E-value=1.4e-29  Score=261.27  Aligned_cols=166  Identities=19%  Similarity=0.352  Sum_probs=146.3

Q ss_pred             CCCCcEEEEcCCCCCCCHHHHHHHhhccCCeEEEEe-----CCCcccEEEEEeCCHHHHHHHHHHhcCcccccceeeeee
Q 002871          191 EHPSRTLFVRNINSNVEDLELRSLFEQYGDIRTLYT-----ACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHF  265 (872)
Q Consensus       191 e~~srtLfV~NLP~~vteeeLr~lFs~fG~I~~v~~-----~~ksrG~AFVeF~d~e~A~~Ai~~Lng~~l~gr~L~V~~  265 (872)
                      ..+.++|||+|||+++|+++|+++|++||+|.+|++     +++++|||||+|.+.++|++|++.+++..+.|+.|++.+
T Consensus        12 ~~p~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~~g~~i~~~~   91 (213)
T 4f02_A           12 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMW   91 (213)
T ss_dssp             ---CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHhhhhhcCCccccccc
Confidence            356799999999999999999999999999999974     467899999999999999999999999999999999999


Q ss_pred             cCCCCCCCCccccccceeeeccCCccchhhHhhhhcccCCeEEEEeC---CCCccEEEEEECCHHHHHHHHHHhCCceeC
Q 002871          266 SIPKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRET---PHKRHHKFIEFYDVRAAEAALRALNRSDIN  342 (872)
Q Consensus       266 a~pk~~~~~~~~~~~tLfV~NLp~~~TeedL~e~Fs~fG~V~~vri~---~~skGfaFVeF~~~e~A~kAl~~LnG~~l~  342 (872)
                      +......  ......+|||+||++++++++|+++|++||.|++|++.   +.++|||||+|.+.++|++|++.|||..|+
T Consensus        92 ~~~~~~~--~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~~~  169 (213)
T 4f02_A           92 SQRDPSL--RKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLN  169 (213)
T ss_dssp             CCCCTHH--HHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEETTEEEEEEEEEESSHHHHHHHHHHHTTCEET
T ss_pred             ccccccc--cccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccCCCCceEEEEEeCCHHHHHHHHHHhCCCEEC
Confidence            8644321  22245689999999999999999999999999999763   446899999999999999999999999999


Q ss_pred             CcEEEEEecCCCcccc
Q 002871          343 GKRIKLEPSRPGGARR  358 (872)
Q Consensus       343 Gr~L~V~~s~p~~~r~  358 (872)
                      |++|+|.+++++..+.
T Consensus       170 g~~i~V~~a~~~~~~~  185 (213)
T 4f02_A          170 DRKVFVGRFKSRKERE  185 (213)
T ss_dssp             TEECEEEECCCHHHHH
T ss_pred             CEEEEEEEcCCCcccc
Confidence            9999999999876544



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 872
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-19
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-15
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-15
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 6e-15
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 8e-15
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-10
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 8e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 9e-15
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-11
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-14
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 6e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-14
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 7e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-13
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 5e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 8e-13
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-12
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-12
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 8e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-08
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 3e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-07
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 4e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 4e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-08
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-10
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 7e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 8e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 9e-10
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 6e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 9e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-09
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-09
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 5e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-07
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 5e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 8e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-07
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 1e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-05
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-07
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 4e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 7e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 7e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 6e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-04
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.002
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 6e-05
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 7e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.001
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-04
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 0.001
d1uw4a_91 d.58.7.4 (A:) RNA processing protein UPF3x, RRM do 0.002
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.1 bits (209), Expect = 1e-19
 Identities = 35/171 (20%), Positives = 60/171 (35%), Gaps = 12/171 (7%)

Query: 194 SRTLFVRNINSNVEDLELRSLFEQYGDIRTLYTAC-----KHRGFVMISYYDIRAARTAM 248
            R LF+  ++    D  LRS FEQ+G +            + RGF  ++Y  +     AM
Sbjct: 6   LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAM 65

Query: 249 RALQNKPLRRRKLDIHFSI-PKDNPSEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVK 307
            A  +K   R                   +    + V  +        LR  F  YG+++
Sbjct: 66  NARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIE 125

Query: 308 EI-----RETPHKRHHKFIEFYDVRAAEAALRALNRSDINGKRIKLEPSRP 353
            I     R +  KR   F+ F D  + +  +       +NG   ++  +  
Sbjct: 126 VIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV-IQKYHTVNGHNCEVRKALS 175


>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query872
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.93
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.64
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.62
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.61
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.61
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.61
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.6
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.6
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.6
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.6
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.59
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.59
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.59
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.58
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.58
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.58
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.58
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.58
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.58
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.58
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.58
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.58
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.58
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.58
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.57
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.57
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.57
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.57
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.56
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.56
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.56
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.56
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.56
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.56
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.55
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.55
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.55
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.55
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.55
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.54
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.54
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.54
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.54
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.54
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.54
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.54
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.54
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.54
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.54
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.53
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.53
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.53
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.53
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.53
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.53
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.53
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.53
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.53
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.53
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.53
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.52
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.52
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.52
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.52
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.52
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.52
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.52
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.52
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.52
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.52
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.52
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.52
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.51
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.51
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.51
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.51
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.5
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.5
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.5
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.5
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.5
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.49
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.49
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.49
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.48
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.48
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.48
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.48
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.48
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.48
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.47
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.47
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.47
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.47
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.47
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.47
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.47
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.47
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.47
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.47
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.46
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.46
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.46
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.46
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.46
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.45
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.45
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.45
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.45
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.45
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.44
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.44
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.44
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.43
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.43
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.43
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.43
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.43
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.43
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.42
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.42
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.41
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.41
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.39
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.39
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.39
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.39
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.38
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.37
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.36
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.36
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.36
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.35
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.35
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.34
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.33
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.3
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.27
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.27
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.21
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.21
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.19
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.19
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.18
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.16
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.14
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.13
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.12
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.11
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.06
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.06
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.95
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.92
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.84
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.83
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.65
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.35
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.54
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.43
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 94.75
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=1.4e-25  Score=222.92  Aligned_cols=162  Identities=20%  Similarity=0.374  Sum_probs=140.3

Q ss_pred             CcEEEEcCCCCCCCHHHHHHHhhccCCeEEEEe-----CCCcccEEEEEeCCHHHHHHHHHHhcCcccccceeeeeecCC
Q 002871          194 SRTLFVRNINSNVEDLELRSLFEQYGDIRTLYT-----ACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIP  268 (872)
Q Consensus       194 srtLfV~NLP~~vteeeLr~lFs~fG~I~~v~~-----~~ksrG~AFVeF~d~e~A~~Ai~~Lng~~l~gr~L~V~~a~p  268 (872)
                      .|+|||+|||+++|+++|+++|++||.|.++.+     ++.++|||||+|.+.++|++|+. +.+..+..+.+.+.+..+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhhh
Confidence            489999999999999999999999999998873     56789999999999999999998 566778888888877655


Q ss_pred             CCCC--CCccccccceeeeccCCccchhhHhhhhcccCCeEEEEe-----CCCCccEEEEEECCHHHHHHHHHHhCCcee
Q 002871          269 KDNP--SEKDVNQGTLVVFNLDASVSNDDLRQIFGAYGEVKEIRE-----TPHKRHHKFIEFYDVRAAEAALRALNRSDI  341 (872)
Q Consensus       269 k~~~--~~~~~~~~tLfV~NLp~~~TeedL~e~Fs~fG~V~~vri-----~~~skGfaFVeF~~~e~A~kAl~~LnG~~l  341 (872)
                      ....  .......++|||+|||..+|+++|+++|+.||.|..+.+     ++.++|||||+|.+.++|.+|++ +++..|
T Consensus        85 ~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~  163 (183)
T d1u1qa_          85 REDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTV  163 (183)
T ss_dssp             TTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEE
T ss_pred             cccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeE
Confidence            4322  122345679999999999999999999999999999965     35678999999999999999997 799999


Q ss_pred             CCcEEEEEecCCCccc
Q 002871          342 NGKRIKLEPSRPGGAR  357 (872)
Q Consensus       342 ~Gr~L~V~~s~p~~~r  357 (872)
                      .|++|+|.+|.|+.++
T Consensus       164 ~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         164 NGHNCEVRKALSKQEM  179 (183)
T ss_dssp             TTEEEEEEECCCHHHH
T ss_pred             CCEEEEEEecCCcccc
Confidence            9999999999887544



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure