Citrus Sinensis ID: 002881

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-

MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

ccccccccEEEEcccccEEEEECcccccEEEEEEccccEEEEEcccccEEEEEEEccccEEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEECccccEEEEEcccccCEEEEECcccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEccccccEEEEEEECcccccEEEEECcccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEECcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccCEEEEcccccEEEEEEEEEEEEEEEEcccCEEECcccCCcEEEECccccccccEEEEEcccccEEEEEEcccEEEEEEEcccccccccCEEEEEcccccEEEEEcccEEEEEEccccEEEEEcccccCEEECccEEEEEEEccEEEEEEcccccEEEEEEccCEEEEEcccccEEEEEEcccEEEEEEccccEEEEcccccccccccccccEEEEEccccEEEEEEECccEEEEEcccccEEEEEccCEEEEEEccccEEEEEEEEcccEEEEEcccccEEEEEEcHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHccccccccccccccccccccccccEEEEcc

*PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKV************EYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Coatomer subunit beta'-2	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	confident	Q9C827
Coatomer subunit beta'-1	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	confident	Q5VQ78
Coatomer subunit beta'	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.	probable	Q54YD8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKQ, chain A
Confidence level:very confident
Coverage over the Query: 4-796
View the alignment between query and template
View the model in PyMOL

Template: 2PM7, chain A
Confidence level:probable
Coverage over the Query: 733-825
View the alignment between query and template
View the model in PyMOL