Citrus Sinensis ID: 002881

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-

MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

ccccccccEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEccccEEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEccccccEEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEEEEEEEEEEEEEcccEEEEEcccEEcEEEEEccccccccEEEEEcccccEEEEEEcccEEEEEEEcccccccccEEEEEEcccccEEEEEcccEEEEEEccccEEEEEcccccEEEEEccEEEEEEEccEEEEEEcccccEEEEEEccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEcccccccccccccccEEEEEccccEEEEEEEEccEEEEEcccccEEEEEccEEEEEEEccccEEEEEEEEcccEEEEEcccccEEEEEEcHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHccccccccccccccccccccccccEEEEcc

ccccEEEEEEEEcccccEEEEEccccccEEEEEccccEEEEEEccccEEEEEEEEccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEcccccEEEEEEEccccccEEEEEccccEEEEEEccccccEEEEccccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccEEEEEEccEEEEEEEEcccccEEcccccccEEcccccccccccEEEEEcccccEEEEEccccEEEEEEHHcccccccccEEEEEEccccEEEEEcccEEEEEEcccEEEEEEccccccccccccEEEEEEcccEEEEEEcccccEEEEEEEccEEEEEcccccEEEEEEcccEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHHccEEcccEEcccEEEEEccccEEEEEEcccEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEcHHHEEHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHcccccccEHEEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHEHHHccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHcccHHHcccHHHHHHHccccHHHHHHHccccccHHHccccEEEEEcc

MPLRLEIKRKLAQRservksvdlhpsepwilASLYSGTVCIWNYQSQTMAKSfevtelpvrsaKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRcvavhptlpyvlsssdDMLIKLWDWekgwmctqifegHSHYVMQVtfnpkdtntfasASLDRTIKIwnlgspdpnftldahqkgvncvdyftggdkpylitgsddhtaKVWDYQTKSCVQtleghthnvsavcfhpelpiiitgsedgtvrIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIgreepvasmdnsGKIIWAKHNeiqtvniksvgadyevtdgerlplavkelgtcdlypqslkhnpngrfvvVCGDGEYIIYTALAWrnrsfgsalefvwssdgeyavreSSSKIKIFSKNfqekrsvrptfsaeriyggTLLAMCSNDFICFYDWAECRLIRRIDVTvknlywadsgdlvaIASDTSFYILKYNRDVVSAYldsgkpvdeqGVEDAFELLHETNERvrtglwvgdcfiynnsswrlnycvggevttmfhldrpMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLEraneilpsipkehHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLqkvnpkaaesladpeeysnLFDDWQVALAVESKaaatrgvhppaedyvnhadKSYMTLVEAFRHMqieeedtlengdlaHEVYSACTCIFTHL

MPLRLEIKRklaqrservksvdlhpsepwILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLypqslkhnpngRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEyavressskikifsknfqekrsvrptfSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETnervrtglwvgDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERAneilpsipkehhNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATevqseskwkQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAaesladpeeYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVREssskikifskNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDlsgllllysslgDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

**************************EPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRE***KIKIFSKNF****SVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQ***KWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKV************EYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFT**

*PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSI****HNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLAS*AKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIV**********************EYSNLFDDWQVAL************************KSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

*PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEVYSACTCIFTHL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		871	2.2.26 [Sep-21-2011]
Q9C827		926	Coatomer subunit beta'-2	yes	no	0.986	0.927	0.903	0.0
Q9CAA0		920	Coatomer subunit beta'-1	no	no	0.981	0.929	0.891	0.0
Q8L828		909	Coatomer subunit beta'-3	no	no	0.987	0.946	0.880	0.0
Q5VQ78		907	Coatomer subunit beta'-1	yes	no	0.987	0.948	0.870	0.0
Q6H8D5		910	Coatomer subunit beta'-2	no	no	0.986	0.943	0.840	0.0
Q6H8D6		910	Putative coatomer subunit	no	no	0.986	0.943	0.838	0.0
O55029		905	Coatomer subunit beta' OS	yes	no	0.944	0.909	0.617	0.0
Q5R664		906	Coatomer subunit beta' OS	yes	no	0.944	0.908	0.616	0.0
P35606		906	Coatomer subunit beta' OS	yes	no	0.944	0.908	0.616	0.0
P35605		906	Coatomer subunit beta' OS	yes	no	0.944	0.908	0.616	0.0

>sp\|Q9C827\|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1	Back alignment and function desciption

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/859 (90%), Positives = 836/859 (97%)

Query: 1   MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPV 60
           MPLRLEIKRKLAQRSERVKSVDLHP+EPWILASLYSGT+CIWNYQ+Q MAKSFEVTELPV
Sbjct: 1   MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPV 60

Query: 61  RSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120
           RSAKFVARKQWVVAGADDM+IRVYNYNTMDKVKVFEAH+DYIRCVAVHPTLPYVLSSSDD
Sbjct: 61  RSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDD 120

Query: 121 MLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180
           MLIKLWDWEKGW CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT
Sbjct: 121 MLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180

Query: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240
           LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
Sbjct: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240

Query: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIG 300
           LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGY+KSSRR+VIGYDEGTIMVK+G
Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLG 300

Query: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLK 360
           RE PVASMDN+GKIIWAKHNEIQT NIKS+GADYEVTDGERLPL+VKELGTCDLYPQSLK
Sbjct: 301 REIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLSVKELGTCDLYPQSLK 360

Query: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQ 420
           HNPNGRFVVVCGDGEYIIYTALAWRNRSFGS LEFVWSS+GE AVRESSSKIKIFSKNFQ
Sbjct: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSGLEFVWSSEGECAVRESSSKIKIFSKNFQ 420

Query: 421 EKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480
           EKRS+RPTFSAE+I+GGTLLAMCS+DFICFYDWAECRLI+RIDVTVKNLYWADSGDLVAI
Sbjct: 421 EKRSIRPTFSAEKIFGGTLLAMCSSDFICFYDWAECRLIQRIDVTVKNLYWADSGDLVAI 480

Query: 481 ASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540
           ASDTSFYILK+NRD+V+++ DSG+P +E+GVEDAFE+LHE +ERVRTG+WVGDCFIYNNS
Sbjct: 481 ASDTSFYILKFNRDLVTSHFDSGRPTEEEGVEDAFEVLHENDERVRTGIWVGDCFIYNNS 540

Query: 541 SWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600
           SW+LNYCVGGEVTTM+HLDRPMYLLGYLASQSRV+L+DKEFNV+GYTLLLSLIEYKTLVM
Sbjct: 541 SWKLNYCVGGEVTTMYHLDRPMYLLGYLASQSRVFLVDKEFNVIGYTLLLSLIEYKTLVM 600

Query: 601 RGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQE 660
           RGDL++A+EILP+IPK+ HNSVA FLESRGMIE+A+E+ATDPDYRFELAIQLGRLE+AQE
Sbjct: 601 RGDLDKASEILPTIPKDQHNSVAHFLESRGMIEDALEIATDPDYRFELAIQLGRLEIAQE 660

Query: 661 IATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLA 720
           IA EVQSESKWKQLGELAMS+GKL+MAE CMK AMDLSGLLLLYSSLGDAEG++KLA+LA
Sbjct: 661 IAVEVQSESKWKQLGELAMSSGKLQMAEECMKYAMDLSGLLLLYSSLGDAEGVTKLATLA 720

Query: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQK 780
           KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVA+WRKDL K
Sbjct: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVALWRKDLSK 780

Query: 781 VNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAF 840
           VN KAAESLADPEEYSNLF+DWQVAL+VE+KA  TRGV+  A+DY +HADKS MTLVEAF
Sbjct: 781 VNSKAAESLADPEEYSNLFEDWQVALSVEAKAVETRGVYTGAKDYPSHADKSSMTLVEAF 840

Query: 841 RHMQIEEEDTLENGDLAHE 859
           R++Q+EEE++LENGD+ HE
Sbjct: 841 RNLQVEEEESLENGDMDHE 859

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9CAA0\|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	Back alignment and function description

>sp\|Q8L828\|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1	Back alignment and function description

>sp\|Q5VQ78\|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1	Back alignment and function description

>sp\|Q6H8D5\|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1	Back alignment and function description

>sp\|Q6H8D6\|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2	Back alignment and function description

>sp\|O55029\|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=2 SV=2	Back alignment and function description

>sp\|Q5R664\|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	Back alignment and function description

>sp\|P35606\|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	Back alignment and function description

>sp\|P35605\|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		871
255574556		914	coatomer beta subunit, putative [Ricinus	0.983	0.937	0.938	0.0
297743300		933	unnamed protein product [Vitis vinifera]	0.986	0.920	0.934	0.0
359482613		952	PREDICTED: coatomer subunit beta'-2-like	0.986	0.902	0.934	0.0
224058817		922	predicted protein [Populus trichocarpa]	0.987	0.932	0.933	0.0
356526157		905	PREDICTED: coatomer subunit beta'-2-like	0.987	0.950	0.930	0.0
147789985		901	hypothetical protein VITISV_004513 [Viti	0.978	0.945	0.933	0.0
356550555		916	PREDICTED: coatomer subunit beta'-2-like	0.987	0.938	0.929	0.0
356556032		920	PREDICTED: coatomer subunit beta'-2-like	0.987	0.934	0.924	0.0
449464258		915	PREDICTED: coatomer subunit beta'-2-like	0.983	0.936	0.919	0.0
449448050		907	PREDICTED: coatomer subunit beta'-2-like	0.981	0.942	0.921	0.0

>gi\|255574556\|ref\|XP_002528189.1\| coatomer beta subunit, putative [Ricinus communis] gi\|223532401\|gb\|EEF34196.1\| coatomer beta subunit, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1679 bits (4348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/859 (93%), Positives = 842/859 (98%), Gaps = 2/859 (0%)

Query: 1   MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPV 60
           MPLRLEIKRKLAQRSERVKSVDLHP+EPWIL SLYSGTVCIWNYQSQTMAKSFEVTELPV
Sbjct: 1   MPLRLEIKRKLAQRSERVKSVDLHPTEPWILVSLYSGTVCIWNYQSQTMAKSFEVTELPV 60

Query: 61  RSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120
           RSAKF+ARKQWVVAGADDMFIRVYNYNTMDK+KVFEAHTDYIRCVAVHPTLPYVLSSSDD
Sbjct: 61  RSAKFIARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120

Query: 121 MLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180
           MLIKLWDWEKGW+CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT
Sbjct: 121 MLIKLWDWEKGWVCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180

Query: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240
           LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
Sbjct: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240

Query: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIG 300
           LPIIITGSEDGTVR+WH+TTYRLENTLNYGLERVWA+GYMK SRRIVIGYDEGTIMVKIG
Sbjct: 241 LPIIITGSEDGTVRLWHSTTYRLENTLNYGLERVWAVGYMKGSRRIVIGYDEGTIMVKIG 300

Query: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLK 360
           REEPVASMDNSGKIIWAKHNEIQTVNIKSVGAD+EVTDGERLPLAVKELGTCDLYPQSLK
Sbjct: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADFEVTDGERLPLAVKELGTCDLYPQSLK 360

Query: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQ 420
           HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRES+SKIKIFSKNFQ
Sbjct: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESTSKIKIFSKNFQ 420

Query: 421 EKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480
           EKRSVRPTFSAERI+GGTLLAMC+NDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI
Sbjct: 421 EKRSVRPTFSAERIFGGTLLAMCANDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480

Query: 481 ASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540
           ASDTSFYILKYNRD+VS+YLDSG+PVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS
Sbjct: 481 ASDTSFYILKYNRDLVSSYLDSGRPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540

Query: 541 SWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600
           SWRLNYCVGGEVTTM+HLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM
Sbjct: 541 SWRLNYCVGGEVTTMYHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600

Query: 601 RGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQE 660
           RGDLERANE+LPSIPKEHHNSVARFLESRGMIE A+EVATDPDY+FELAIQLGRLE+A+E
Sbjct: 601 RGDLERANELLPSIPKEHHNSVARFLESRGMIENALEVATDPDYKFELAIQLGRLEIAKE 660

Query: 661 IATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLA 720
           IATEVQSESKWKQLGELA+STGKLEMAE CMK+A DLSGLLLLYSSLGDAEGISKLA LA
Sbjct: 661 IATEVQSESKWKQLGELAISTGKLEMAEECMKRATDLSGLLLLYSSLGDAEGISKLAPLA 720

Query: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQK 780
           KEQGKNNVAFLCLFMLGKLEDCLQ+LVESNRIPEAALMARSYLPSKV EIVA+WRKDL K
Sbjct: 721 KEQGKNNVAFLCLFMLGKLEDCLQILVESNRIPEAALMARSYLPSKVPEIVALWRKDLNK 780

Query: 781 VNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAF 840
           VNPKAAESLADP+EY NLFDDWQVAL+VE++ A TRGV+PPAE+Y+NHAD++ +TLVEAF
Sbjct: 781 VNPKAAESLADPDEYPNLFDDWQVALSVETRVAETRGVYPPAEEYLNHADRTNITLVEAF 840

Query: 841 RHMQIEEEDTLENGDLAHE 859
           R+MQ+EE   LENGD  HE
Sbjct: 841 RNMQVEE--PLENGDYDHE 857

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297743300\|emb\|CBI36167.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482613\|ref\|XP_002284773.2\| PREDICTED: coatomer subunit beta'-2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224058817\|ref\|XP_002299635.1\| predicted protein [Populus trichocarpa] gi\|222846893\|gb\|EEE84440.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356526157\|ref\|XP_003531686.1\| PREDICTED: coatomer subunit beta'-2-like [Glycine max]	Back alignment and taxonomy information

>gi\|147789985\|emb\|CAN59846.1\| hypothetical protein VITISV_004513 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356550555\|ref\|XP_003543651.1\| PREDICTED: coatomer subunit beta'-2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356556032\|ref\|XP_003546331.1\| PREDICTED: coatomer subunit beta'-2-like [Glycine max]	Back alignment and taxonomy information

>gi\|449464258\|ref\|XP_004149846.1\| PREDICTED: coatomer subunit beta'-2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449448050\|ref\|XP_004141779.1\| PREDICTED: coatomer subunit beta'-2-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		871
TAIR\|locus:2016214		1135	AT1G79990 [Arabidopsis thalian	0.985	0.755	0.864	0.0
ZFIN\|ZDB-GENE-010724-7		934	copb2 "coatomer protein comple	0.944	0.881	0.607	4.9e-291
UNIPROTKB\|P35606		906	COPB2 "Coatomer subunit beta'"	0.944	0.908	0.601	1e-290
UNIPROTKB\|F1SL54		906	COPB2 "Uncharacterized protein	0.944	0.908	0.601	2.1e-290
UNIPROTKB\|P35605		906	COPB2 "Coatomer subunit beta'"	0.944	0.908	0.601	3.4e-290
RGD\|628746		905	Copb2 "coatomer protein comple	0.944	0.909	0.600	3.4e-290
UNIPROTKB\|E1C016		913	COPB2 "Uncharacterized protein	0.944	0.901	0.604	5.6e-290
MGI\|MGI:1354962		905	Copb2 "coatomer protein comple	0.944	0.909	0.602	3.1e-289
UNIPROTKB\|E2R667		906	COPB2 "Uncharacterized protein	0.944	0.908	0.602	6.4e-289
UNIPROTKB\|B4DZI8		877	COPB2 "Coatomer protein comple	0.911	0.905	0.593	7.2e-277

TAIR\|locus:2016214 AT1G79990 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3998 (1412.4 bits), Expect = 0., P = 0.
 Identities = 743/859 (86%), Positives = 799/859 (93%)

Query:     2 PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVR 61
             PLRLEIKRK AQRSERVKSVDLHP+EPWILASLYSGT+CIWNYQ+QTM KSF+VTELPVR
Sbjct:   217 PLRLEIKRKFAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQTMVKSFDVTELPVR 276

Query:    62 SAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDM 121
             SAKF+ARKQWVVAGADDMFIRVYNYNTMDK+KVFEAH DYIRCVAVHPTLPYVLSSSDDM
Sbjct:   277 SAKFIARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDM 336

Query:   122 LIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL 181
             LIKLWDWEKGW+CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL
Sbjct:   337 LIKLWDWEKGWLCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL 396

Query:   182 DAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPEL 241
             DAH KGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAV FHPEL
Sbjct:   397 DAHLKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVSFHPEL 456

Query:   242 PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGR 301
             PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIG++K SRR+VIGYDEG+IMVK+GR
Sbjct:   457 PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGHIKGSRRVVIGYDEGSIMVKLGR 516

Query:   302 EEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKH 361
             E PVASMDNSGKIIWAKHNEI TVNIKSVGAD EVTDGERLPLAVKELGTCDLYPQSLKH
Sbjct:   517 EIPVASMDNSGKIIWAKHNEIHTVNIKSVGAD-EVTDGERLPLAVKELGTCDLYPQSLKH 575

Query:   362 NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVREXXXXXXXXXXNFQE 421
             NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGE+AVRE          NFQE
Sbjct:   576 NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEHAVRESSTKIKIFSKNFQE 635

Query:   422 KRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA 481
             K++VRPTFSAE I+GGTLL MCS+DFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA
Sbjct:   636 KKTVRPTFSAEHIFGGTLLTMCSSDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA 695

Query:   482 SDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSS 541
             SDTSFYILK+NRD+VS+Y D GK +DE+G+EDAFELL+ETNERVRTGLWVGDCFIY NSS
Sbjct:   696 SDTSFYILKFNRDIVSSYFDGGKQIDEEGIEDAFELLNETNERVRTGLWVGDCFIYTNSS 755

Query:   542 WRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMR 601
             WRLNYCVGGEVTTM+HLDRPMYLLGYLA+QSRVYLIDKEFNV+GYTLLLSLIEYKTLVMR
Sbjct:   756 WRLNYCVGGEVTTMYHLDRPMYLLGYLANQSRVYLIDKEFNVIGYTLLLSLIEYKTLVMR 815

Query:   602 GDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEI 661
             GDLE+ANE+LPSIPKEHHNSVA FLESRGM E+A+EVATDPDYRFELAIQLGRL VA++I
Sbjct:   816 GDLEQANEVLPSIPKEHHNSVAHFLESRGMTEDALEVATDPDYRFELAIQLGRLAVAKDI 875

Query:   662 ATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDXXXXXXXXXXXXDAEGISKLASLAK 721
             A E Q+ESKWKQLGELAMS+GKL+MAE CM+ AMD            DA+G+ KLA+LAK
Sbjct:   876 AVEAQNESKWKQLGELAMSSGKLDMAEECMRHAMDLSGLLLLYSSLGDADGMMKLAALAK 935

Query:   722 EQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKV 781
             EQGKNNVAFLCLFMLG++EDCL LLVESNRIPEAALMARSYLPSKVSEIVA+WR DL K+
Sbjct:   936 EQGKNNVAFLCLFMLGQVEDCLHLLVESNRIPEAALMARSYLPSKVSEIVALWRNDLTKI 995

Query:   782 NPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFR 841
             +PKAAESLADPEEY NLF++WQVAL++E++AA TRGVHPPA DY +HAD+ + TLV+AFR
Sbjct:   996 SPKAAESLADPEEYPNLFEEWQVALSLENRAAETRGVHPPAGDYCSHADRDHTTLVDAFR 1055

Query:   842 HMQIEEEDTLENGDLAHEV 860
              MQIEEE  LE GD+  EV
Sbjct:  1056 IMQIEEEGRLEQGDVLDEV 1074

GO:0000139 "Golgi membrane" evidence=IEA

GO:0005198 "structural molecule activity" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0005886 "plasma membrane" evidence=ISM

GO:0006886 "intracellular protein transport" evidence=IEA

GO:0016192 "vesicle-mediated transport" evidence=IEA

GO:0030117 "membrane coat" evidence=IEA

GO:0030126 "COPI vesicle coat" evidence=ISS

GO:0005829 "cytosol" evidence=IDA

GO:0006094 "gluconeogenesis" evidence=RCA

GO:0006661 "phosphatidylinositol biosynthetic process" evidence=RCA

GO:0007010 "cytoskeleton organization" evidence=RCA

GO:0010498 "proteasomal protein catabolic process" evidence=RCA

ZFIN\|ZDB-GENE-010724-7 copb2 "coatomer protein complex, subunit beta 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|P35606 COPB2 "Coatomer subunit beta'" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SL54 COPB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|P35605 COPB2 "Coatomer subunit beta'" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|628746 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C016 COPB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1354962 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R667 COPB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DZI8 COPB2 "Coatomer protein complex, subunit beta 2 (Beta prime), isoform CRA_b" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P35605	COPB2_BOVIN	No assigned EC number	0.6162	0.9448	0.9083	yes	no
P35606	COPB2_HUMAN	No assigned EC number	0.6162	0.9448	0.9083	yes	no
P41811	COPB2_YEAST	No assigned EC number	0.4697	0.8897	0.8717	yes	no
O35142	COPB2_RAT	No assigned EC number	0.6150	0.9448	0.9093	yes	no
Q6H8D6	COB23_ORYSJ	No assigned EC number	0.8385	0.9862	0.9439	no	no
Q6H8D5	COB22_ORYSJ	No assigned EC number	0.8408	0.9862	0.9439	no	no
O42937	COPB2_SCHPO	No assigned EC number	0.4621	0.9081	0.9937	yes	no
Q4R4I8	COPB2_MACFA	No assigned EC number	0.6113	0.9448	0.9083	N/A	no
O55029	COPB2_MOUSE	No assigned EC number	0.6174	0.9448	0.9093	yes	no
Q9C827	COB22_ARATH	No assigned EC number	0.9033	0.9862	0.9276	yes	no
Q5R664	COPB2_PONAB	No assigned EC number	0.6162	0.9448	0.9083	yes	no
Q8L828	COB23_ARATH	No assigned EC number	0.8802	0.9873	0.9460	no	no
Q20168	COPB2_CAEEL	No assigned EC number	0.5331	0.9644	0.84	yes	no
Q5VQ78	COB21_ORYSJ	No assigned EC number	0.8705	0.9873	0.9481	yes	no
Q54YD8	COPB2_DICDI	No assigned EC number	0.5762	0.9494	0.8228	yes	no
O62621	COPB2_DROME	No assigned EC number	0.5679	0.9425	0.8982	yes	no
Q9CAA0	COB21_ARATH	No assigned EC number	0.8913	0.9816	0.9293	no	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00034434001	SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1017 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00036398001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (889 aa)	•	•	•	•	0.568
	GSVIVG00030145001	SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (568 aa)	•	•	•	•	0.433

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		871
pfam04053		429	pfam04053, Coatomer_WDAD, Coatomer WD associated r	0.0
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	1e-67
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	7e-59
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	3e-45
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	1e-38
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	3e-38
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	3e-37
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	5e-17
smart00320		40	smart00320, WD40, WD40 repeats	4e-11
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	5e-11
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	1e-10
smart00320		40	smart00320, WD40, WD40 repeats	4e-08
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	4e-08
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	6e-08
smart00320		40	smart00320, WD40, WD40 repeats	2e-07
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	6e-06
smart00320		40	smart00320, WD40, WD40 repeats	7e-06
PTZ00421		493	PTZ00421, PTZ00421, coronin; Provisional	1e-04
PTZ00421		493	PTZ00421, PTZ00421, coronin; Provisional	5e-04
PTZ00420		568	PTZ00420, PTZ00420, coronin; Provisional	0.003
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	0.004

>gnl\|CDD\|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region	Back alignment and domain information

 Score =  581 bits (1501), Expect = 0.0
 Identities = 215/447 (48%), Positives = 301/447 (67%), Gaps = 20/447 (4%)

Query: 320 NEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIY 379
           +E+++ NIK       + DGE LPL++KELG+ ++YPQSL HNPNGRFV+VCGDGEYIIY
Sbjct: 1   SEVRSYNIKGN----NLKDGELLPLSLKELGSTEVYPQSLSHNPNGRFVLVCGDGEYIIY 56

Query: 380 TALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEK--RSVRPTFSAERIYGG 437
           TALAWRN++FGS L+FVW S   YAV E S  +KIF KNF+E   +S++  +S ++I+GG
Sbjct: 57  TALAWRNKAFGSGLDFVWVSRNRYAVLEKSGTVKIF-KNFKESVTKSIKLPYSVDKIFGG 115

Query: 438 TLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVS 497
            LL + S  F+ FYDW + +LIRRIDV+ K + W+D G+LVA+ +  + YIL YN + V 
Sbjct: 116 ALLGVKSESFVSFYDWEQGKLIRRIDVSPKYVIWSDDGELVALLTKDTVYILNYNLEAV- 174

Query: 498 AYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFH 557
                      +GVEDAFE+LHE  ERV++G W GD FIY   +  L Y V GE   + H
Sbjct: 175 ----------AEGVEDAFEVLHEVTERVKSGAWDGDVFIYTTLN-HLKYLVNGETGIIKH 223

Query: 558 LDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKE 617
           LD+PMYLLGYL   +RVYL+D++ NV+ Y +  + +E+KT ++R D E    I+ +    
Sbjct: 224 LDKPMYLLGYLPKDNRVYLLDRDGNVVSYEIDPTELEFKTALLRKDYEEVLRIIAN-SNL 282

Query: 618 HHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGEL 677
               + RFLE +G  E A++  TDPD RF+LA++LG L+VA EIA E+  E KWK+LG+ 
Sbjct: 283 LGQKIIRFLEKKGYPELALQFVTDPDTRFDLALELGNLDVALEIAKELDDEHKWKRLGDA 342

Query: 678 AMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLG 737
           A+S G +++AE   ++A D   LLLLY S G+ E + KLA +A+E+G  N AF     LG
Sbjct: 343 ALSQGNIKLAEEAYQKAKDFDKLLLLYLSTGNKEKLKKLAKIAEERGDYNSAFQNALYLG 402

Query: 738 KLEDCLQLLVESNRIPEAALMARSYLP 764
            +E C+ +L+++ R+PEA L A++Y P
Sbjct: 403 DVEKCVDILIKTGRLPEAYLFAKTYGP 429

This region is composed of WD40 repeats. Length = 429

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|173611 PTZ00421, PTZ00421, coronin; Provisional	Back alignment and domain information

>gnl\|CDD\|173611 PTZ00421, PTZ00421, coronin; Provisional	Back alignment and domain information

>gnl\|CDD\|240412 PTZ00420, PTZ00420, coronin; Provisional	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		871
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	100.0
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	100.0
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	100.0
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0279		315	consensus G protein beta subunit-like protein [Sig	100.0
KOG2041		1189	consensus WD40 repeat protein [General function pr	100.0
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	100.0
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	100.0
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	100.0
KOG0295		406	consensus WD40 repeat-containing protein [Function	100.0
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	100.0
KOG0284		464	consensus Polyadenylation factor I complex, subuni	100.0
KOG0315		311	consensus G-protein beta subunit-like protein (con	100.0
KOG0279		315	consensus G protein beta subunit-like protein [Sig	100.0
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	100.0
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	100.0
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	100.0
KOG0263		707	consensus Transcription initiation factor TFIID, s	100.0
KOG0645		312	consensus WD40 repeat protein [General function pr	100.0
KOG0296		399	consensus Angio-associated migratory cell protein	100.0
KOG0284		464	consensus Polyadenylation factor I complex, subuni	100.0
KOG0315		311	consensus G-protein beta subunit-like protein (con	100.0
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0316		307	consensus Conserved WD40 repeat-containing protein	100.0
KOG0266		456	consensus WD40 repeat-containing protein [General	100.0
KOG0293		519	consensus WD40 repeat-containing protein [Function	100.0
KOG0263		707	consensus Transcription initiation factor TFIID, s	100.0
KOG0296		399	consensus Angio-associated migratory cell protein	100.0
KOG2106		626	consensus Uncharacterized conserved protein, conta	100.0
PLN00181		793	protein SPA1-RELATED; Provisional	100.0
KOG0645		312	consensus WD40 repeat protein [General function pr	100.0
KOG0275		508	consensus Conserved WD40 repeat-containing protein	100.0
KOG0278		334	consensus Serine/threonine kinase receptor-associa	100.0
KOG0282		503	consensus mRNA splicing factor [Function unknown]	100.0
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	100.0
KOG2048		691	consensus WD40 repeat protein [General function pr	100.0
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	100.0
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	100.0
KOG0295		406	consensus WD40 repeat-containing protein [Function	100.0
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	100.0
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.98
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.97
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.97
KOG2041		1189	consensus WD40 repeat protein [General function pr	99.97
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.97
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.97
KOG1539		910	consensus WD repeat protein [General function pred	99.97
KOG0643		327	consensus Translation initiation factor 3, subunit	99.97
KOG0266		456	consensus WD40 repeat-containing protein [General	99.97
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.97
PLN00181		793	protein SPA1-RELATED; Provisional	99.97
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.97
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.97
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.97
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.97
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	99.97
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.97
KOG0643		327	consensus Translation initiation factor 3, subunit	99.96
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.96
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.96
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.96
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.96
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.96
KOG2048		691	consensus WD40 repeat protein [General function pr	99.96
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.96
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.96
KOG1539		910	consensus WD repeat protein [General function pred	99.96
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.96
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.96
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.96
PTZ00421		493	coronin; Provisional	99.96
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.96
KOG0289		506	consensus mRNA splicing factor [General function p	99.96
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.96
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.96
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.96
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.96
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.95
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.95
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.95
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.95
KOG0641		350	consensus WD40 repeat protein [General function pr	99.95
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.95
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.95
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.95
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.95
PTZ00420		568	coronin; Provisional	99.95
PTZ00421		493	coronin; Provisional	99.95
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.95
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.94
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.94
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.94
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.94
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.94
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.94
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.94
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.94
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.94
KOG0289		506	consensus mRNA splicing factor [General function p	99.94
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.94
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.94
PTZ00420		568	coronin; Provisional	99.94
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.93
KOG2055		514	consensus WD40 repeat protein [General function pr	99.93
KOG0641		350	consensus WD40 repeat protein [General function pr	99.93
KOG1274		933	consensus WD40 repeat protein [General function pr	99.93
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.93
KOG0639		705	consensus Transducin-like enhancer of split protei	99.93
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.93
KOG2096		420	consensus WD40 repeat protein [General function pr	99.93
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.92
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.92
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.92
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.92
KOG2096		420	consensus WD40 repeat protein [General function pr	99.92
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.92
KOG0646		476	consensus WD40 repeat protein [General function pr	99.92
KOG4328		498	consensus WD40 protein [Function unknown]	99.92
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.92
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.92
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.92
KOG1273		405	consensus WD40 repeat protein [General function pr	99.91
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.91
KOG0267		825	consensus Microtubule severing protein katanin p80	99.91
KOG0646		476	consensus WD40 repeat protein [General function pr	99.91
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.9
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.9
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.9
KOG0267		825	consensus Microtubule severing protein katanin p80	99.9
KOG2055		514	consensus WD40 repeat protein [General function pr	99.89
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.89
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.89
KOG1274		933	consensus WD40 repeat protein [General function pr	99.88
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.88
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.88
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.88
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.88
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.88
KOG1273		405	consensus WD40 repeat protein [General function pr	99.88
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.88
KOG4328		498	consensus WD40 protein [Function unknown]	99.88
KOG0639		705	consensus Transducin-like enhancer of split protei	99.88
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.87
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.87
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	99.87
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.87
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.86
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.86
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.86
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.85
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.85
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.85
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.85
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.84
KOG1188		376	consensus WD40 repeat protein [General function pr	99.84
COG2319		466	FOG: WD40 repeat [General function prediction only	99.84
KOG1963		792	consensus WD40 repeat protein [General function pr	99.84
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.84
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.83
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.83
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.83
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.83
KOG1963		792	consensus WD40 repeat protein [General function pr	99.82
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.82
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.82
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.81
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.81
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.81
KOG4227		609	consensus WD40 repeat protein [General function pr	99.8
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.79
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.78
KOG0649		325	consensus WD40 repeat protein [General function pr	99.78
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.78
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	99.78
COG2319		466	FOG: WD40 repeat [General function prediction only	99.77
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.76
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.76
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.76
KOG1310		758	consensus WD40 repeat protein [General function pr	99.76
KOG1334		559	consensus WD40 repeat protein [General function pr	99.76
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.75
KOG1912		1062	consensus WD40 repeat protein [General function pr	99.75
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.74
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.74
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.73
KOG0649		325	consensus WD40 repeat protein [General function pr	99.72
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.72
KOG4227		609	consensus WD40 repeat protein [General function pr	99.72
KOG3616		1636	consensus Selective LIM binding factor [Transcript	99.72
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.71
KOG1188		376	consensus WD40 repeat protein [General function pr	99.71
PRK01742		429	tolB translocation protein TolB; Provisional	99.7
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.7
PRK11028		330	6-phosphogluconolactonase; Provisional	99.7
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.69
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.69
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.68
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.68
KOG2139		445	consensus WD40 repeat protein [General function pr	99.68
KOG1310		758	consensus WD40 repeat protein [General function pr	99.66
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.66
PRK11028		330	6-phosphogluconolactonase; Provisional	99.66
PRK01742		429	tolB translocation protein TolB; Provisional	99.65
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.65
KOG2139		445	consensus WD40 repeat protein [General function pr	99.65
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.64
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.62
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.62
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.61
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.61
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.61
KOG2321		703	consensus WD40 repeat protein [General function pr	99.6
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.6
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.59
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.59
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.58
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.58
PRK03629		429	tolB translocation protein TolB; Provisional	99.57
PRK02889		427	tolB translocation protein TolB; Provisional	99.56
KOG1334		559	consensus WD40 repeat protein [General function pr	99.56
PRK03629		429	tolB translocation protein TolB; Provisional	99.55
PRK04922		433	tolB translocation protein TolB; Provisional	99.54
PRK05137		435	tolB translocation protein TolB; Provisional	99.54
KOG2315		566	consensus Predicted translation initiation factor	99.53
PRK02889		427	tolB translocation protein TolB; Provisional	99.52
KOG2315		566	consensus Predicted translation initiation factor	99.51
KOG2314		698	consensus Translation initiation factor 3, subunit	99.51
PRK04922		433	tolB translocation protein TolB; Provisional	99.5
PRK05137		435	tolB translocation protein TolB; Provisional	99.49
KOG2314		698	consensus Translation initiation factor 3, subunit	99.49
KOG1912		1062	consensus WD40 repeat protein [General function pr	99.48
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.48
KOG1409		404	consensus Uncharacterized conserved protein, conta	99.47
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.47
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.46
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.46
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.45
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.45
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.44
COG4946		668	Uncharacterized protein related to the periplasmic	99.43
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.41
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.39
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.39
PRK00178		430	tolB translocation protein TolB; Provisional	99.38
PRK04792		448	tolB translocation protein TolB; Provisional	99.36
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.35
PRK00178		430	tolB translocation protein TolB; Provisional	99.34
PRK01029		428	tolB translocation protein TolB; Provisional	99.33
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	99.32
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.32
KOG4547		541	consensus WD40 repeat-containing protein [General	99.32
PRK01029		428	tolB translocation protein TolB; Provisional	99.31
KOG2321		703	consensus WD40 repeat protein [General function pr	99.31
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.3
PRK04792		448	tolB translocation protein TolB; Provisional	99.3
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.29
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.28
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.28
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.27
KOG3616		1636	consensus Selective LIM binding factor [Transcript	99.27
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	99.25
KOG4547		541	consensus WD40 repeat-containing protein [General	99.25
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.23
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	99.17
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	99.16
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	99.16
COG4946		668	Uncharacterized protein related to the periplasmic	99.12
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.1
KOG4532		344	consensus WD40-like repeat containing protein [Gen	99.09
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	99.08
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	99.07
KOG1409		404	consensus Uncharacterized conserved protein, conta	99.05
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	99.05
PRK04043		419	tolB translocation protein TolB; Provisional	99.04
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	99.02
PRK04043		419	tolB translocation protein TolB; Provisional	98.99
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.99
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.99
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.98
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.96
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.96
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	98.93
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.92
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.92
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.92
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.92
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.91
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.9
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.88
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.88
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.88
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	98.86
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.84
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.79
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.77
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.76
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.74
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.71
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.68
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.68
KOG3621		726	consensus WD40 repeat-containing protein [General	98.67
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	98.67
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	98.66
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	98.66
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	98.64
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.62
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	98.6
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	98.58
KOG2695		425	consensus WD40 repeat protein [General function pr	98.57
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	98.57
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.56
KOG2695		425	consensus WD40 repeat protein [General function pr	98.51
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	98.4
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.39
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.39
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	98.39
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.38
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.37
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	98.32
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	98.31
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.31
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	98.27
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.19
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	98.18
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	98.17
KOG1008		783	consensus Uncharacterized conserved protein, conta	98.16
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	98.15
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.11
PRK02888		635	nitrous-oxide reductase; Validated	98.08
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	98.08
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	98.06
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.06
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	98.05
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	98.05
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	98.03
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	98.0
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.97
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	97.95
PRK02888		635	nitrous-oxide reductase; Validated	97.91
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	97.87
KOG3621		726	consensus WD40 repeat-containing protein [General	97.84
COG3391		381	Uncharacterized conserved protein [Function unknow	97.83
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	97.8
COG3391		381	Uncharacterized conserved protein [Function unknow	97.76
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.75
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	97.69
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	97.69
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	97.68
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	97.65
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	97.57
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	97.56
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	97.46
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	97.45
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	97.43
PRK13616		591	lipoprotein LpqB; Provisional	97.36
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	97.35
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	97.24
KOG2280		829	consensus Vacuolar assembly/sorting protein VPS16	97.17
PHA02713		557	hypothetical protein; Provisional	97.07
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	97.06
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	97.06
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	97.06
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	97.05
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	97.04
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	97.03
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	97.03
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	97.0
PRK13616		591	lipoprotein LpqB; Provisional	96.99
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	96.99
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.98
PF14727		418	PHTB1_N: PTHB1 N-terminus	96.97
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.95
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	96.91
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	96.89
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	96.87
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	96.87
PRK10115		686	protease 2; Provisional	96.85
KOG2247		615	consensus WD40 repeat-containing protein [General	96.84
KOG2444		238	consensus WD40 repeat protein [General function pr	96.75
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	96.74
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	96.72
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	96.7
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	96.62
PF14727		418	PHTB1_N: PTHB1 N-terminus	96.51
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	96.5
PHA02713		557	hypothetical protein; Provisional	96.5
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	96.48
KOG2395		644	consensus Protein involved in vacuole import and d	96.42
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	96.41
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	96.35
TIGR03074		764	PQQ_membr_DH membrane-bound PQQ-dependent dehydrog	96.28
KOG2395		644	consensus Protein involved in vacuole import and d	96.25
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	96.21
PRK10115		686	protease 2; Provisional	96.2
PRK13684		334	Ycf48-like protein; Provisional	96.17
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	96.16
KOG3630		1405	consensus Nuclear pore complex, Nup214/CAN compone	96.15
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	96.15
KOG2444		238	consensus WD40 repeat protein [General function pr	96.15
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	96.14
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	96.12
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	96.02
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	95.98
COG3292		671	Predicted periplasmic ligand-binding sensor domain	95.91
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	95.79
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	95.75
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	95.66
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	95.53
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	95.52
KOG2247		615	consensus WD40 repeat-containing protein [General	95.5
KOG2280		829	consensus Vacuolar assembly/sorting protein VPS16	95.44
PRK13684		334	Ycf48-like protein; Provisional	95.42
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	95.38
PHA03098		534	kelch-like protein; Provisional	95.35
KOG2076		895	consensus RNA polymerase III transcription factor	95.34
PLN03077		857	Protein ECB2; Provisional	95.29
PHA03098		534	kelch-like protein; Provisional	95.25
PLN03218		1060	maturation of RBCL 1; Provisional	95.17
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	95.14
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	95.02
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	94.84
PLN03218		1060	maturation of RBCL 1; Provisional	94.82
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	94.71
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	94.62
KOG3630		1405	consensus Nuclear pore complex, Nup214/CAN compone	94.44
PHA02790		480	Kelch-like protein; Provisional	94.41
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	94.39
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	94.37
PHA02790		480	Kelch-like protein; Provisional	94.29
TIGR03074		764	PQQ_membr_DH membrane-bound PQQ-dependent dehydrog	94.11
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	93.93
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	93.93
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	93.89
KOG2003		840	consensus TPR repeat-containing protein [General f	93.86
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	93.79
PRK11788		389	tetratricopeptide repeat protein; Provisional	93.65
PRK10370		198	formate-dependent nitrite reductase complex subuni	93.62
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	93.51
KOG1983		993	consensus Tomosyn and related SNARE-interacting pr	93.37
PRK15359		144	type III secretion system chaperone protein SscB;	93.29
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	93.28
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	93.11
KOG2076		895	consensus RNA polymerase III transcription factor	93.07
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	92.92
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	92.82
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	92.75
PLN03077		857	Protein ECB2; Provisional	92.74
KOG1898		1205	consensus Splicing factor 3b, subunit 3 [RNA proce	92.57
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	92.56
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	92.53
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	92.47
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	92.33
KOG1586		288	consensus Protein required for fusion of vesicles	92.27
KOG2377		657	consensus Uncharacterized conserved protein [Funct	92.25
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	92.08
PF10313		43	DUF2415: Uncharacterised protein domain (DUF2415);	92.05
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	91.85
KOG3060		289	consensus Uncharacterized conserved protein [Funct	91.77
PF14781		136	BBS2_N: Ciliary BBSome complex subunit 2, N-termin	91.68
PRK12370		553	invasion protein regulator; Provisional	91.6
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	91.53
PF10214		765	Rrn6: RNA polymerase I-specific transcription-init	91.53
PF08728		717	CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans	91.48
KOG0553		304	consensus TPR repeat-containing protein [General f	91.46
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	91.39
COG1520		370	FOG: WD40-like repeat [Function unknown]	91.38
PF00637		143	Clathrin: Region in Clathrin and VPS; InterPro: IP	91.37
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	91.28
KOG2377		657	consensus Uncharacterized conserved protein [Funct	91.26
KOG4460		741	consensus Nuclear pore complex, Nup88/rNup84 compo	91.25
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	91.19
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	91.14
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	91.0
PF10313		43	DUF2415: Uncharacterised protein domain (DUF2415);	90.98
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	90.88
PRK11788		389	tetratricopeptide repeat protein; Provisional	90.82
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	90.81
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	90.78
PF12768		281	Rax2: Cortical protein marker for cell polarity	90.48
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	90.46
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	90.42
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	90.27
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	90.22
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	90.18
smart00036		302	CNH Domain found in NIK1-like kinases, mouse citro	90.16

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Probab=100.00  E-value=1.5e-146  Score=1099.38  Aligned_cols=793  Identities=67%  Similarity=1.169  Sum_probs=780.8

Q ss_pred             ChhhhhhhcccCCCCEEEEEEcCCCCEEEEEEcCCeEEEEeCCCCceeEEeeecCCCEEEEEEeCCCCEEEEEeCCCeEE
Q 002881            3 LRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIR   82 (871)
Q Consensus         3 ~~~~~~~~~~~h~~~v~~i~~s~~~~~la~~~~dg~v~iwd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~dg~i~   82 (871)
                      +++++++++..|+++|++++|||..++++++.++|.|.|||++++.+++.++..+.||++..|.+..+|+++|++|+.|+
T Consensus         1 ~~l~~krk~~~rSdRVKsVd~HPtePw~la~LynG~V~IWnyetqtmVksfeV~~~PvRa~kfiaRknWiv~GsDD~~Ir   80 (794)
T KOG0276|consen    1 MKLDFKRKFQSRSDRVKSVDFHPTEPWILAALYNGDVQIWNYETQTMVKSFEVSEVPVRAAKFIARKNWIVTGSDDMQIR   80 (794)
T ss_pred             CcchhhhHhhccCCceeeeecCCCCceEEEeeecCeeEEEecccceeeeeeeecccchhhheeeeccceEEEecCCceEE
Confidence            35677888888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCCCcEEEEEccCCCCeEEEEEcCCCCEEEEEECCCeEEEEECCCCceEEEEeecCCcceEEEEEecCCCCEEEEEE
Q 002881           83 VYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASAS  162 (871)
Q Consensus        83 iw~~~~~~~~~~~~~~~~~i~~i~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~  162 (871)
                      |||++|+++++.|.+|++.|+|++.+|+.++++++|+|.+|++||++.++.+.+++.+|.+.|++++|+|++.+.|++++
T Consensus        81 Vfnynt~ekV~~FeAH~DyIR~iavHPt~P~vLtsSDDm~iKlW~we~~wa~~qtfeGH~HyVMqv~fnPkD~ntFaS~s  160 (794)
T KOG0276|consen   81 VFNYNTGEKVKTFEAHSDYIRSIAVHPTLPYVLTSSDDMTIKLWDWENEWACEQTFEGHEHYVMQVAFNPKDPNTFASAS  160 (794)
T ss_pred             EEecccceeeEEeeccccceeeeeecCCCCeEEecCCccEEEEeeccCceeeeeEEcCcceEEEEEEecCCCccceeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEEECCCCCCeEEEecCCCCeeEEEEeecCCcCEEEEEeCCCeEEEEECCCCceEEEecCcccCeEEEEEcCCCC
Q 002881          163 LDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELP  242 (871)
Q Consensus       163 ~dg~i~i~d~~~~~~~~~~~~~~~~i~~i~~~~~~~~~~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~v~~i~~~p~~~  242 (871)
                      .|++|++|.+.+..+.+++.+|..+|+|+.|.+.|++|++++|++|..++|||+++.+|++++.+|.++|+.++|+|.-+
T Consensus       161 LDrTVKVWslgs~~~nfTl~gHekGVN~Vdyy~~gdkpylIsgaDD~tiKvWDyQtk~CV~TLeGHt~Nvs~v~fhp~lp  240 (794)
T KOG0276|consen  161 LDRTVKVWSLGSPHPNFTLEGHEKGVNCVDYYTGGDKPYLISGADDLTIKVWDYQTKSCVQTLEGHTNNVSFVFFHPELP  240 (794)
T ss_pred             ccccEEEEEcCCCCCceeeeccccCcceEEeccCCCcceEEecCCCceEEEeecchHHHHHHhhcccccceEEEecCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEECCCcEEEEeCCCCeEEEEEecCCccEEEEEEeeCCCeEEEEEcCCeEEEecCCCcceEEEeCCCcEEEEeecce
Q 002881          243 IIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEI  322 (871)
Q Consensus       243 ~l~~~~~dg~v~iwd~~~~~~~~~~~~~~~~i~~i~~~~~~~~l~~g~~dg~i~i~~~~~~~~~~~~~~~~~~~~~~~~~  322 (871)
                      ++++||+||+++||+..|.++..+++...+++|+++..+.++.+++|+++|.+.+.++.+.|.++|+.+|+++|+.++++
T Consensus       241 iiisgsEDGTvriWhs~Ty~lE~tLn~gleRvW~I~~~k~~~~i~vG~Deg~i~v~lgreeP~vsMd~~gKIiwa~~~ei  320 (794)
T KOG0276|consen  241 IIISGSEDGTVRIWNSKTYKLEKTLNYGLERVWCIAAHKGDGKIAVGFDEGSVTVKLGREEPAVSMDSNGKIIWAVHSEI  320 (794)
T ss_pred             EEEEecCCccEEEecCcceehhhhhhcCCceEEEEeecCCCCeEEEeccCCcEEEEccCCCCceeecCCccEEEEcCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeecCcceeccCCCeeeeeeeecCccccCCceEEECCCCCEEEEEcCCcEEEEEeecccccCcCceeEEEEecC-C
Q 002881          323 QTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSD-G  401 (871)
Q Consensus       323 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~g~~lav~~~~~~~i~~~~~~~~~~~~~~~~~~~s~~-~  401 (871)
                      +..++.+.....++.||+++++.++++++++.+|+.+++||+|+++++|++|+++||+...||++.+|+...++|+++ +
T Consensus       321 ~~~~~ks~~~~~ev~DgErL~LsvKeLgs~eiyPq~L~hsPNGrfV~VcgdGEyiIyTala~RnK~fG~~~eFvw~~dsn  400 (794)
T KOG0276|consen  321 QAVNLKSVGAQKEVTDGERLPLSVKELGSVEIYPQTLAHSPNGRFVVVCGDGEYIIYTALALRNKAFGSGLEFVWAADSN  400 (794)
T ss_pred             eeeeceeccCcccccCCccccchhhhccccccchHHhccCCCCcEEEEecCccEEEEEeeehhhcccccceeEEEcCCCC
Confidence            999999988888899999999999999999999999999999999999999999999999999999999999999998 6


Q ss_pred             cEEEEecCCeEEEeecccccceeeecCccceeeecCcEEEEEeCCeEEEEeccCCcEEEEEEcceeEEEEcCCCCEEEEE
Q 002881          402 EYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA  481 (871)
Q Consensus       402 ~~~~~~~~~~i~i~~~~~~~~~~~~~~~s~~~i~~~~~La~~~~~~v~~~d~~~~~~~~~~~~~i~~i~~s~~~~~la~~  481 (871)
                      .|++..+++.|+++ .+|++.+++++.++.+.|+||.+|++.+++.++||||++++++++++..+++++|+.+|.+++++
T Consensus       401 e~avRes~~~vki~-knfke~ksi~~~~~~e~i~gg~Llg~~ss~~~~fydW~~~~lVrrI~v~~k~v~w~d~g~lVai~  479 (794)
T KOG0276|consen  401 EFAVRESNGNVKIF-KNFKEHKSIRPDMSAEGIFGGPLLGVRSSDFLCFYDWESGELVRRIEVTSKHVYWSDNGELVAIA  479 (794)
T ss_pred             eEEEEecCCceEEE-ecceeccccccccceeeecCCceEEEEeCCeEEEEEcccceEEEEEeeccceeEEecCCCEEEEE
Confidence            89999999999999 99999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCeEEEEEecHHHHHhhhhCCCCCCccccccceeeeeeeeeEEEeeEEeccEEEEEccCCeEEEEECCeEeEEEecccc
Q 002881          482 SDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRP  561 (871)
Q Consensus       482 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~i~~~~w~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~  561 (871)
                      +++.++++.++++.+..+.+++..++++|++++|+.+.|..+.++++.|.+|+|+|++.+++++|+++++..++.+++.+
T Consensus       480 ~d~Sfyil~~n~d~v~~a~e~g~~v~eeGiedAfevLgE~sE~v~tg~WvgD~fiytts~nrlnY~vgGe~~~v~h~~~~  559 (794)
T KOG0276|consen  480 GDDSFYILKFNADAVANAVEQGIEVTEEGIEDAFEVLGEVSESVKTGKWVGDCFIYTTSNNRLNYLVGGETYTVAHLDRI  559 (794)
T ss_pred             ecCceeEEEecHHHHHHHHhcCCCCcchhHHHHHHHHhhhhhheeeceeeeeEEEEeecccceeEEcCCceEEEEEeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEeeeCCEEEEEecCCceEEEEecchhHhHHHHHHccCHHHHhhhCCCCCcchhHHHHHHHHhCCChhhhhhcccC
Q 002881          562 MYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATD  641 (871)
Q Consensus       562 ~~~~~~~~~~~~l~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~l~~i~~~~~~~~~~~~~~~~~~~~a~~~~~~  641 (871)
                      +|+++|+++++|+|+.|++.++.+|.+.+++++||++++++|++.|.+.+++|+.+++.++++|++++|+.++||+++.|
T Consensus       560 mylLgy~~~~~rvYL~Dke~nVi~y~l~l~vleyqt~vmrrd~~~a~~vLp~I~k~~rt~va~Fle~~g~~e~AL~~s~D  639 (794)
T KOG0276|consen  560 MYLLGYVANDNRVYLHDKELNVISYKILLEVLEYQTLVLRRDLEVADGVLPTIPKEIRTKVAHFLESQGMKEQALELSTD  639 (794)
T ss_pred             hhheeeeecCCEEEEeecccceEeEeeehHHHHHHHHhhhccccccccccccCchhhhhhHHhHhhhccchHhhhhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeeeeccCCHHHHHHHHHHcCChHHHHHHHHHHHHcCChhhHHHHHHHcCCcchhHHHHHhcCCHHHHHHHHHHHH
Q 002881          642 PDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAK  721 (871)
Q Consensus       642 ~~~~f~~~l~l~~~~~A~~~~~~~~~~~~w~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~~~~~~~~~l~~~~~  721 (871)
                      |+++||+++++|+++.|+++|.+.+++.+|++||++|++.+++.+|.+||.+++|+.+|+++|+..|+.+++..++..+.
T Consensus       640 ~d~rFelal~lgrl~iA~~la~e~~s~~Kw~~Lg~~al~~~~l~lA~EC~~~a~d~~~LlLl~t~~g~~~~l~~la~~~~  719 (794)
T KOG0276|consen  640 PDQRFELALKLGRLDIAFDLAVEANSEVKWRQLGDAALSAGELPLASECFLRARDLGSLLLLYTSSGNAEGLAVLASLAK  719 (794)
T ss_pred             hhhhhhhhhhcCcHHHHHHHHHhhcchHHHHHHHHHHhhcccchhHHHHHHhhcchhhhhhhhhhcCChhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCchHHHHHHHHcCCHHHHHHHHHHCCCchHHHHHHHhcCCchHHHHHHHHHHHhhhhChhhhhhcCCCccCC
Q 002881          722 EQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYS  796 (871)
Q Consensus       722 ~~~~~~~a~~~~~~~g~~~~a~~l~~~~~~~~~A~~la~~~~~~~~~~~~~~~~~~L~~~~~~~a~~l~~~~~~~  796 (871)
                      ++|++|.||.++++.|++++|.+++++++|++||+.|||+|+|+++.+++.+|++.|.+.++|+|++|+||++|+
T Consensus       720 ~~g~~N~AF~~~~l~g~~~~C~~lLi~t~r~peAal~ArtYlps~vs~iv~~wk~~l~k~~~k~~~sladp~~~~  794 (794)
T KOG0276|consen  720 KQGKNNLAFLAYFLSGDYEECLELLISTQRLPEAALFARTYLPSQVSRIVELWKEDLSKVSEKAAESLADPEEYS  794 (794)
T ss_pred             hhcccchHHHHHHHcCCHHHHHHHHHhcCcCcHHHHHHhhhChHHHHHHHHHHHHHhhhhhhhhhhhccCccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999884

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF14727 PHTB1_N: PTHB1 N-terminus	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>KOG2247 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF14727 PHTB1_N: PTHB1 N-terminus	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG2247 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2377 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I []	Back alignment and domain information

>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes []	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>COG1520 FOG: WD40-like repeat [Function unknown]	Back alignment and domain information

>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>KOG2377 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		871
3mkq_A		814	Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco		0.0
2ynp_A		604	Yeast Betaprime Cop 1-604 With Ktktn Motif Length =		0.0
2yno_A		310	Yeast Betaprime Cop 1-304h6 Length = 310		1e-109
2ynn_A		304	Yeast Betaprime Cop 1-304 With Ktktn Motif Length =		1e-109
1vyh_C		410	Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410		2e-29
1vyh_C		410	Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410		1e-18
2ymu_A		577	Structure Of A Highly Repetitive Propeller Structur		3e-27
2ymu_A		577	Structure Of A Highly Repetitive Propeller Structur		4e-23
3mxx_A		315	Crystal Structure Of Wdr5 Mutant (S62a) Length = 31		3e-22
3mxx_A		315	Crystal Structure Of Wdr5 Mutant (S62a) Length = 31		8e-17
3mxx_A		315	Crystal Structure Of Wdr5 Mutant (S62a) Length = 31		2e-06
2cnx_A		315	Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.		4e-22
2cnx_A		315	Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.		1e-16
2cnx_A		315	Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.		3e-06
3n0d_A		315	Crystal Structure Of Wdr5 Mutant (W330f) Length = 3		6e-22
3n0d_A		315	Crystal Structure Of Wdr5 Mutant (W330f) Length = 3		4e-17
3n0d_A		315	Crystal Structure Of Wdr5 Mutant (W330f) Length = 3		2e-06
3n0e_A		315	Crystal Structure Of Wdr5 Mutant (W330y) Length = 3		6e-22
3n0e_A		315	Crystal Structure Of Wdr5 Mutant (W330y) Length = 3		4e-17
3n0e_A		315	Crystal Structure Of Wdr5 Mutant (W330y) Length = 3		2e-06
2h9l_A		329	Wdr5delta23 Length = 329		1e-21
2h9l_A		329	Wdr5delta23 Length = 329		5e-17
2h9l_A		329	Wdr5delta23 Length = 329		1e-06
3emh_A		318	Structural Basis Of Wdr5-Mll Interaction Length = 3		1e-21
3emh_A		318	Structural Basis Of Wdr5-Mll Interaction Length = 3		6e-17
3emh_A		318	Structural Basis Of Wdr5-Mll Interaction Length = 3		8e-07
2h13_A		317	Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length		1e-21
2h13_A		317	Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length		5e-17
2h13_A		317	Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length		1e-06
3psl_A		318	Fine-Tuning The Stimulation Of Mll1 Methyltransfera		1e-21
3psl_A		318	Fine-Tuning The Stimulation Of Mll1 Methyltransfera		5e-17
3psl_A		318	Fine-Tuning The Stimulation Of Mll1 Methyltransfera		1e-06
2g9a_A		311	Structural Basis For The Specific Recognition Of Me		1e-21
2g9a_A		311	Structural Basis For The Specific Recognition Of Me		6e-17
2g9a_A		311	Structural Basis For The Specific Recognition Of Me		2e-06
3smr_A		312	Crystal Structure Of Human Wd Repeat Domain 5 With		1e-21
3smr_A		312	Crystal Structure Of Human Wd Repeat Domain 5 With		5e-17
3smr_A		312	Crystal Structure Of Human Wd Repeat Domain 5 With		1e-06
2h68_A		312	Histone H3 Recognition And Presentation By The Wdr5		1e-21
2h68_A		312	Histone H3 Recognition And Presentation By The Wdr5		5e-17
2h68_A		312	Histone H3 Recognition And Presentation By The Wdr5		1e-06
2gnq_A		336	Structure Of Wdr5 Length = 336		1e-21
2gnq_A		336	Structure Of Wdr5 Length = 336		5e-17
4a7j_A		318	Symmetric Dimethylation Of H3 Arginine 2 Is A Novel		1e-21
4a7j_A		318	Symmetric Dimethylation Of H3 Arginine 2 Is A Novel		5e-17
4a7j_A		318	Symmetric Dimethylation Of H3 Arginine 2 Is A Novel		1e-06
2xl2_A		334	Wdr5 In Complex With An Rbbp5 Peptide Recruited To		1e-21
2xl2_A		334	Wdr5 In Complex With An Rbbp5 Peptide Recruited To		4e-17
2h9m_A		313	Wdr5 In Complex With Unmodified H3k4 Peptide Length		1e-21
2h9m_A		313	Wdr5 In Complex With Unmodified H3k4 Peptide Length		5e-17
2h9m_A		313	Wdr5 In Complex With Unmodified H3k4 Peptide Length		1e-06
2g99_A		308	Structural Basis For The Specific Recognition Of Me		1e-21
2g99_A		308	Structural Basis For The Specific Recognition Of Me		6e-17
2g99_A		308	Structural Basis For The Specific Recognition Of Me		1e-06
2co0_A		315	Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs		2e-21
2co0_A		315	Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs		1e-16
2co0_A		315	Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs		3e-06
2ovp_B		445	Structure Of The Skp1-Fbw7 Complex Length = 445		5e-21
2ovp_B		445	Structure Of The Skp1-Fbw7 Complex Length = 445		4e-20
3zey_7		318	High-resolution Cryo-electron Microscopy Structure		1e-18
1p22_A		435	Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex		3e-18
1p22_A		435	Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex		2e-10
3dm0_A		694	Maltose Binding Protein Fusion With Rack1 From A. T		1e-17
3dm0_A		694	Maltose Binding Protein Fusion With Rack1 From A. T		6e-12
2pbi_B		354	The Multifunctional Nature Of Gbeta5RGS9 REVEALED F		1e-16
2pbi_B		354	The Multifunctional Nature Of Gbeta5RGS9 REVEALED F		2e-10
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		2e-16
3sfz_A		1249	Crystal Structure Of Full-Length Murine Apaf-1 Leng		6e-16
3shf_A		1256	Crystal Structure Of The R265s Mutant Of Full-Lengt		6e-16
3iz6_a		380	Localization Of The Small Subunit Ribosomal Protein		7e-16
1erj_A		393	Crystal Structure Of The C-Terminal Wd40 Domain Of		8e-16
1erj_A		393	Crystal Structure Of The C-Terminal Wd40 Domain Of		3e-15
2bcj_B		340	Crystal Structure Of G Protein-coupled Receptor Kin		3e-14
3sn6_B		351	Crystal Structure Of The Beta2 Adrenergic Receptor-		3e-14
1gg2_B		340	G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet		3e-14
3ow8_A		321	Crystal Structure Of The Wd Repeat-Containing Prote		5e-14
3ow8_A		321	Crystal Structure Of The Wd Repeat-Containing Prote		6e-05
4aow_A		340	Crystal Structure Of The Human Rack1 Protein At A R		6e-14
2zkq_a		317	Structure Of A Mammalian Ribosomal 40s Subunit With		6e-14
1a0r_B		340	Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-		6e-14
1got_B		340	Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer		7e-14
1nex_B		464	Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp		1e-13
3mks_B		464	Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH		2e-13
3fm0_A		345	Crystal Structure Of Wd40 Protein Ciao1 Length = 34		1e-11
3fm0_A		345	Crystal Structure Of Wd40 Protein Ciao1 Length = 34		3e-06
3frx_A		319	Crystal Structure Of The Yeast Orthologue Of Rack1,		1e-10
1trj_A		314	Homology Model Of Yeast Rack1 Protein Fitted Into 1		1e-10
3izb_a		319	Localization Of The Small Subunit Ribosomal Protein		1e-10
3jyv_R		313	Structure Of The 40s Rrna And Proteins And PE TRNA		1e-10
3rfg_A		319	Crystal Structure Of The Yeast Rack1 Dimer In Space		1e-10
3rfh_A		319	Crystal Structure Of The Yeast Rack1 Dimer In Space		1e-10
4gga_A		420	Structural Analysis Of Human Cdc20 Supports Multi-S		2e-10
4ggd_A		431	Structural Analysis Of Human Cdc20 Supports Multisi		2e-10
4ggc_A		318	Structural Analysis Of Human Cdc20 Supports Multi-S		3e-10
2hes_X		330	Cytosolic Iron-sulphur Assembly Protein- 1 Length =		5e-10
3c99_A		432	Structural Basis Of Histone H4 Recognition By P55 L		2e-09
2xyi_A		430	Crystal Structure Of Nurf55 In Complex With A H4 Pe		2e-09
2yba_A		422	Crystal Structure Of Nurf55 In Complex With Histone		2e-09
2xzm_R		343	Crystal Structure Of The Eukaryotic 40s Ribosomal S		3e-09
2xzm_R		343	Crystal Structure Of The Eukaryotic 40s Ribosomal S		6e-07
3cfv_B		414	Structural Basis Of The Interaction Of Rbap46RBAP48		5e-09
4g56_B		357	Crystal Structure Of Full Length Prmt5/mep50 Comple		5e-09
3cfs_B		414	Structural Basis Of The Interaction Of Rbap46RBAP48		6e-09
3odt_A		313	Crystal Structure Of Wd40 Beta Propeller Domain Of		1e-08
3gfc_A		425	Crystal Structure Of Histone-Binding Protein Rbbp4		2e-08
4gqb_B		344	Crystal Structure Of The Human Prmt5:mep50 Complex		1e-07
4a11_B		408	Structure Of The Hsddb1-Hscsa Complex Length = 408		2e-06
3acp_A		417	Crystal Structure Of Yeast Rpn14, A Chaperone Of Th		2e-06
3acp_A		417	Crystal Structure Of Yeast Rpn14, A Chaperone Of Th		5e-04
3vl1_A		420	Crystal Structure Of Yeast Rpn14 Length = 420		2e-06
3vl1_A		420	Crystal Structure Of Yeast Rpn14 Length = 420		5e-04
1nr0_A		611	Two Seven-Bladed Beta-Propeller Domains Revealed By		4e-06
1gxr_A		337	Wd40 Region Of Human Groucho/tle1 Length = 337		6e-06
3mmy_A		368	Structural And Functional Analysis Of The Interacti		8e-06
2aq5_A		402	Crystal Structure Of Murine Coronin-1 Length = 402		2e-05
1pi6_A		615	Yeast Actin Interacting Protein 1 (Aip1), Orthorhom		2e-05
2b4e_A		402	Crystal Structure Of Murine Coronin-1: Monoclinic F		5e-05
1pgu_A		615	Yeast Actin Interacting Protein 1 (aip1), Se-met Pr		1e-04
3ei4_B		436	Structure Of The Hsddb1-Hsddb2 Complex Length = 436		2e-04
4e5z_B		436	Damaged Dna Induced Uv-Damaged Dna-Binding Protein		2e-04
4e54_B		435	Damaged Dna Induced Uv-Damaged Dna-Binding Protein		2e-04
4aez_A		401	Crystal Structure Of Mitotic Checkpoint Complex Len		2e-04
3jro_A		753	Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice		4e-04
3gre_A		437	Crystal Structure Of Saccharomyces Cerevisiae Vps15		6e-04
3mkq_B		177	Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco		7e-04
2qxv_A		361	Structural Basis Of Ezh2 Recognition By Eed Length		7e-04
3jzn_A		366	Structure Of Eed In Apo Form Length = 366		7e-04
3iiw_A		365	Crystal Structure Of Eed In Complex With A Trimethy		8e-04
3iiy_A		365	Crystal Structure Of Eed In Complex With A Trimethy		9e-04
3jrp_A		379	Sec13 With Nup145c (Aa109-179) Insertion Blade Leng		9e-04

>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814