Citrus Sinensis ID: 002896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------87
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKSHKPASRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccCEEEEEccccccCEEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccCEECcccccccccccccEEEccccccCCcccccccccccccEEEccccCEECcccccccccccccEEEcccccccccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccCEcccccHHHHcccccccccccccCEEEcccccccccccccEEEccccccccccccccccccccccEEcccccccccccccccccccccEEEccccCCcccccccccccccccEEEccccCEECccccccccccccccccccccccCECccccccccccccEEcccccccccccHHHcccccccEEEccccCEECcccccccccccccEEEcccccccccccccHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccHHHHcccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEEEccccEEEEcccHHHHccc
****NLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQS**********SRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQS*PRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQV*
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKSHKPASRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6Q, chain A
Confidence level:very confident
Coverage over the Query: 68-288
View the alignment between query and template
View the model in PyMOL
Template: 2O6Q, chain A
Confidence level:very confident
Coverage over the Query: 515-725
View the alignment between query and template
View the model in PyMOL
Template: 1W8A, chain A
Confidence level:very confident
Coverage over the Query: 611-745
View the alignment between query and template
View the model in PyMOL
Template: 2Z7X, chain B
Confidence level:very confident
Coverage over the Query: 230-465,486-726
View the alignment between query and template
View the model in PyMOL
Template: 2Z7X, chain B
Confidence level:very confident
Coverage over the Query: 182-325,348-484,507-699
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 158-386,402-790,802-866
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 32-334
View the alignment between query and template
View the model in PyMOL