Citrus Sinensis ID: 002933

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----

MSSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPDVPTAVSGITHGKQKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGVTLAEEAAAKAKAELEAAESKLSLVDGEPVLGGNPARLSRLKLHAEKAKNEEISAKESLEAKEALFARAVEENEALYLSLYRNFSNVLMERLPDASRAGTLQDLKSTHADAMAVDLEEPSAMELDNENGRPKKSQSNGGSSGNVYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRPIN

ccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHcccccHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccc

**SWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPD************QKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGVTLA**************************************************AKESLEAKEALFARAVEENEALYLSLYRNFSNVLMER****************************************************VYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRP**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPDVPTAVSGITHGKQKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVLGGNPARLSRLKLHxxxxxxxxxxxxxxxxxxxxxFARAVEENEALYLSLYRNFSNVLMERLPDASRAGTLQDLKSTHADAMAVDLEEPSAMELDNENGRPKKSQSNGGSSGNVYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRPIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear cap-binding protein subunit 1	Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary miRNA processing. In the CBC complex, ABH1/CBP80 does not bind directly capped RNAs (m7GpppG-capped RNA) but is required to stabilize the movement of the N-terminal loop of CBP20 and lock the CBC into a high affinity cap-binding state with the cap structure. Involved in flowering regulation, possibly by regulating pre-mRNA splicing of FLC gene. Acts as a negative regulator of abscisic acid signaling in guard cells.	probable	Q9SIU2
Nuclear cap-binding protein subunit 1	Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary miRNA processing. In the CBC complex, ABH1/CBP80 does not bind directly capped RNAs (m7GpppG-capped RNA) but is required to stabilize the movement of the N-terminal loop of CBP20 and lock the CBC into a high affinity cap-binding state with the cap structure.	probable	Q10LJ0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H2V, chain C
Confidence level:very confident
Coverage over the Query: 2-264,282-652,713-760,808-861
View the alignment between query and template
View the model in PyMOL