Citrus Sinensis ID: 002971


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860--
MTVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKITEYLCDPLQRCLKDDDPYVRKTAAICVAKLYDINAELVEDRGFLESLKDLISDNNPMVVANAVAALAEIEENSSRPIFEITSHTLSKLLTALNECTEWGQVFILDALSRYKAADAREAENIVERVTPRLQHANCAVVLSAVKMILQQMELITSTDVVRNLCKKMAPPLVTLLSAEPEIQYVALRNINLIVQRRPTILAHEIKVFFCKYNDPIYVKMEKLEIMIKLASDRNIDQVLLEFKEYATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLELIKIKVNYVVQEAIIVIKDIFRRYPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAERIDNADELLESFLESFPEEPAQVQLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKDVVLAEKPVISDDSNQLDPSLLDELLANIATLSSVYHKPPEAFVTRVKTTASRTDDEDYPNGSEQGYSDAPTHVADEGASPQTSSSNAPYAATRQPAPPPAAPVSPPVPDLLGDLIGLDNSAAIVPADQAAASPVPALPVVLPASTGQGLQIGAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQVPQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNPDIASLFFEAIETLLKA
ccccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECccEEEEEEEEECcccccccccEEEEcccccccccccccccccccccccEEEEEEEEEccccccccccccEEEEEEcccccEEEEEEccCEEEEEcccccccHHHHHHHHccccccccEEEcccccccccHHHHHHHHHcccEEEEEccccccccEEEEEEECccccEEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHcc
*TVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKITEYLCDPLQRCLKDDDPYVRKTAAICVAKLYDINAELVEDRGFLESLKDLISDNNPMVVANAVAALAEIEENSSRPIFEITSHTLSKLLTALNECTEWGQVFILDALSRYKAADAREAENIVERVTPRLQHANCAVVLSAVKMILQQMELITSTDVVRNLCKKMAPPLVTLLSAEPEIQYVALRNINLIVQRRPTILAHEIKVFFCKYNDPIYVKMEKLEIMIKLASDRNIDQVLLEFKEYATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLELIKIKVNYVVQEAIIVIKDIFRRYPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAERIDNADELLESFLESFPEEPAQVQLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKDVVLAEKPV**********SLLDELLANIATLSSVYHKPPEAFV********************************************************************GDL*GLDNSAAIVPADQAAASPVPALPVVLPASTGQGLQIGAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQVPQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNPDIASLFFEAIETLLKA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKITEYLCDPLQRCLKDDDPYVRKTAAICVAKLYDINAELVEDRGFLESLKDLISDNNPMVVANAVAALAEIEENSSRPIFEITSHTLSKLLTALNECTEWGQVFILDALSRYKAADAREAENIVERVTPRLQHANCAVVLSAVKMILQQMELITSTDVVRNLCKKMAPPLVTLLSAEPEIQYVALRNINLIVQRRPTILAHEIKVFFCKYNDPIYVKMEKLEIMIKLASDRNIDQVLLEFKEYATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLELIKIKVNYVVQEAIIVIKDIFRRYPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAERIDNADELLESFLESFPEEPAQVQLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKDVVLAEKPVISDDSNQLDPSLLDELLANIATLSSVYHKPPEAFVTRVKTTASRTDDEDYPNGSEQGYSDAPTHVADEGASPQTSSSNAPYAATRQPAPPPAAPVSPPVPDLLGDLIGLDNSAAIVPADQAAASPVPALPVVLPASTGQGLQIGAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQVPQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNPDIASLFFEAIETLLKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-adaptin-like protein C Subunit of clathrin-associated adaptor protein complex that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.confidentO81742
AP-1 complex subunit beta-1 Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.probableQ10567
AP-2 complex subunit beta Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins; at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly; clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly.probableP62944

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain B
Confidence level:very confident
Coverage over the Query: 1-541
View the alignment between query and template
View the model in PyMOL
Template: 2G30, chain A
Confidence level:very confident
Coverage over the Query: 631-862
View the alignment between query and template
View the model in PyMOL