Citrus Sinensis ID: 003014

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------

MNKLEAVEDAGLGSSTSTNSQPVQASVRTFSDSTVATSSATALSTTTSWMPTIPSFSTPPGLFVTPQTQAPPGLLTLRTKDTSSAFGDFYSSAGLRPSVPTPSAPSNSGSAIQHQIYPTYPSLPPIGVSPQGPLLRPPQMGVRPWLPFLPYPAAYPSPFPLPAHGMPNPSVSQIDAQPPGLSSVRTAAATSHSAIPGHQLVGTSGNTEAPPSGTDKKEHVHDVSSRIGASVNEQLDAWTAHKTDTGIVYYYNAVTGESTYEKPAGFKGEPDKVPVQPTPISMEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQIPSEVTELKKKEDDDTLKEQSVPNTNIVIEKGSNAISLSSPAVNTGGRDATALRTSSMPGSSSALDLIKKKLQDSGTPTASPAPVSSAAATSESNGSKAVEVTVKGLQNENTKDKLKDINGDGTMSDSSSDSEDGETGPTKEECIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVKTRAEEERKEKRAAQKAAIEGFKQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVLPLKRAAEEKAQAIRAAAASSFKSMLREKGDITLSSRWSKVKDILRDDPRYKSVRHEDREVIFNEYVRELKAAEEEAEREAKARREEQEKLKEREREMRKRKEREEQEMERVRLKVRRKEAVTSFQALLVETIKDPQASWTESRPKLEKDPQGRATNADLDSSDREKLFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAEEIQRKHKSSLDQNEDNHKDSKSRSSTDGGRPPSSSRRNQERR

ccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHcccccccccccccccccHcccc

*******************************************************************************************************************************************MGVRPWLPFLPYPAAY*******************************************************************************LDAWTAHKTDTGIVYYYNAVTGESTY*********************MEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQIPS********************************************************************************************************************************************CIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVKT********************KQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVL***********************M**********SRWSKVKDILRDDPRYKSVRHEDREVIFNEYVREL*******************************************LKVRRKEAVTSFQALLVETIKDPQASWTESRPKLEK******************LFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAEE*****************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNKLEAVEDAGLGSSTSTNSQPVQASVRTFSDSTVATSSATALSTTTSWMPTIPSFSTPPGLFVTPQTQAPPGLLTLRTKDTSSAFGDFYSSAGLRPSVPTPSAPSNSGSAIQHQIYPTYPSLPPIGVSPQGPLLRPPQMGVRPWLPFLPYPAAYPSPFPLPAHGMPNPSVSQIDAQPPGLSSVRTAAATSHSAIPGHQLVGTSGNTEAPPSGTDKKEHVHDVSSRIGASVNEQLDAWTAHKTDTGIVYYYNAVTGESTYEKPAGFKGEPDKVPVQPTPISMEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQIPSEVTELKKKEDDDTLKEQSVPNTNIVIEKGSNAISLSSPAVNTGGRDATALRTSSMPGSSSALDLIKKKLQDSGTPTASPAPVSSAAATSESNGSKAVEVTVKGLQNENTKDKLKDINGDGTMSDSSSDSEDGETGPTKEECIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVKTRAEEERKEKRAAQKAAIEGFKQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVLPLKRAAEEKAQAIRAAAASSFKSMLREKGDITLSSRWSKVKDILRDDPRYKSVRHEDREVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSFQALLVETIKDPQASWTESRPKLEKDPQGRATNADLDSSDREKLFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAEEIQRKHKSSLDQNEDNHKDSKSRSSTDGGRPPSSSRRNQERR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pre-mRNA-processing protein 40C	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Interacts with both the phosphorylated and the dephosphorylated forms of the CTD domain of the RPB1 subunit of the RNA polymerase II.	probable	Q9LT25

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DOF, chain A
Confidence level:very confident
Coverage over the Query: 684-760
View the alignment between query and template
View the model in PyMOL

Template: 2DOE, chain A
Confidence level:very confident
Coverage over the Query: 446-513
View the alignment between query and template
View the model in PyMOL

Template: 2DOF, chain A
Confidence level:very confident
Coverage over the Query: 749-766,779-827
View the alignment between query and template
View the model in PyMOL

Template: 2DOE, chain A
Confidence level:very confident
Coverage over the Query: 589-646
View the alignment between query and template
View the model in PyMOL

Template: 2L5F, chain A
Confidence level:very confident
Coverage over the Query: 232-272,283-322
View the alignment between query and template
View the model in PyMOL

Template: 2CQN, chain A
Confidence level:very confident
Coverage over the Query: 521-581
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 563-637
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 184-239
View the alignment between query and template
View the model in PyMOL

Template: 3PGW, chain B
Confidence level:probable
Coverage over the Query: 27-36
View the alignment between query and template
View the model in PyMOL