Citrus Sinensis ID: 003032

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-----

MNNNNNNNSSSTPNPNANTNNKDSEEDLAAQPVETVIKPDKSDTLSSAAAAEEEASAKSDDPMDEDSVTPATVFCIRLKQPRSNLQHKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSNANTPFWIPIHIVIPERPTECAVFNVIADCPRDSVQFIEWSPTSCPRALLIANFYGRVTIWTQPSHGPANLVRDASCWQREHEWRQDIAVVTKWLSGVSPYRWLSSKSTSPLNAKSIFEEKFLSQNSQTSDRWPNFLCVCSVFSSGSVQLNWSQWPPSQNGAASKWFPTAKGLLGAGPSGIMAADVIITDSGAMHVAGVPIVNPSTVVVWEVTPGPGNGFQAAPKTTTSNGVPPSLSPPKWAGFAPLAAYLFSWQEYLLSEAKQGRKLTDQNFSDAITLHCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGGSVIAVVIVEGQYMSPYDPDEGPSITGWRVQRWESSVQPVVLHQIFGNPTSSFGGQAPMQTVWVSKVDTSIPTSNFKIHQLAAAGPTCDVWKTTDSGLEKSKIVSFDPFDLPSDIRSLARIVYSAHGGEIAIALLRGGVHIFSGPNFAPVDNYQISVGSAIAAPAFSSTSCCSASVWHDTNKDRTILKIIRVLPPAVPSSQVKANSSTWERAIAERFWWSLLVNVDWWDAVGCTQSAAEDGIVSLNSVIAVLDADFHSLPSIQHRQQYGPSLDRIKCRLLEGTNAQEVRAMVLDMQARLLLDMLGKGIESALINPSALVPDPWQASGETLSGIDPEAMAVEPALVASIQAYVDAVLDLASHFITRLRRYASFCRTLASHAVTAGTGSNRNMVASPTQSSATPAASQGQYPPLL

ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccEEEEEEEcccccccccccccHHHHcccccHHHccccccEEccccccccccccccccccEEEEEEEcccccccEEEEEEEcccccccEEEEEEcccccccEEEEEEccccEEEEEcccccccccccccccccHHHHcccccEEEEEccccccccccccccccccccccHHHHHHHcccccccccccccEEEEEEEEccccEEEECcccccccccccccEEEcccccccccccccccccEEEcccccEEEEEEccccccEEEEEEECccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccCECcccccccEEEccccccccccccCCccccEEEEccccccccEEEEEEEEccccccccccccccccCEEEEEECcccccEEEECcccccccccccccccEEEEEEEECccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHEEEcccccEEEEEEEcccEEEEEcccccccccEEEEccccccccccccccccccEEECccccccEEEEEEECccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEcccccccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc

*********************************************************************PATVFCIRLKQPRSNLQHKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSNANTPFWIPIHIVIPERPTECAVFNVIADCPRDSVQFIEWSPTSCPRALLIANFYGRVTIWTQPSHGPANLVRDASCWQREHEWRQDIAVVTKWLSGVSPYRWLS*************************DRWPNFLCVCSVFSSGSVQLNWSQWPPSQNGAASKWFPTAKGLLGAGPSGIMAADVIITDSGAMHVAGVPIVNPSTVVVWEVTPGPGNGFQAAPKTTT*******LSPPKWAGFAPLAAYLFSWQEYLLSEAKQGRKLTDQNFSDAITLHCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGGSVIAVVIVEGQYMSPYDPDEGPSITGWRVQRWESSVQPVVLHQIFGNPTSSFGGQAPMQTVWVSKVDTSIPTSNFKIHQLAA****************KSKIVSFDPFDLPSDIRSLARIVYSAHGGEIAIALLRGGVHIFSGPNFAPVDNYQISVGSAIAAPAFSSTSCCSASVWHDTNKDRTILKIIRVLPPAVPSSQVKANSSTWERAIAERFWWSLLVNVDWWDAVGCTQSAAEDGIVSLNSVIAVLDADFHSLPSIQHRQQYGPSLDRIKCRLLEGTNAQEVRAMVLDMQARLLLDMLGKGIESALINPSALVPDPWQASGETLSGIDPEAMAVEPALVASIQAYVDAVLDLASHFITRLRRYASFCRTLASHAVT*******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mediator of RNA polymerase II transcription subunit 16	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Involved in the regulation of the circadian clock, in the control of flowering time, in freezing- and osmotic-stress tolerance and in both salicylic acid- and jasmonate-mediated defense gene expression.	probable	F4JGZ1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GGA, chain A
Confidence level:probable
Coverage over the Query: 89-119,135-188
View the alignment between query and template
View the model in PyMOL