Citrus Sinensis ID: 003050


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850---
MSMQHRGLRSDLQACFSSVQSAITSHAQANHAIIKGKIVIDHSPGQSGPGKSASVQIFSCTKVDPGTGKGKLSHIAYLKNGKSHKHNGTKTTTYKLKFYVEPDFGNPGAFVIENQHKYKFFLQAATLHAPDNQAIHFDCRSWVYPIKLTKTPRIFFSNKSYLPSETPSTLKDLRKQELISLRGDGTGERKEWERIYDYDYYNDLGDPDIGPENARPVLGGSESLPYPRRGRTGRPKCRADLSTESRPEKINLDIYVPPDERFSPKKLSEFIGNSIRASLHFLIPEANSLLEKDPHFRSFDEIRGMFSSNKSRKVEGWLTKKLQKLLPEQLFKQITRASKGDPMRFPEPQIIANNDLAWKEDEEFGRQMLAGINPTRIRCLEAFPPKGKNGKMSSITLADIEGSLDGLDITQAMNQWRIYILDHHDYLMPFLSRINTSSVCAYASRTLLFLRSDATLKPVAIELSLPSISSDEVNRVFLPAKEGIEAALWQLAKAHVLANDSAYHQLVTHWLHTHAVVEPFVIATRRQLSVMHPVHRLLDPHFKDTMHVNALARSILLNAGGILEKTLFPGKICMELSSELYKEWRFDEQALPKDLIKRRLALEDSDLPTGCQILFQDYPYGLDGLDVWLAIMTWVKDYCSIFYKDDDSVKSDEEIQAWWKEIREVGHGDKRNASWWFEMNSRDNLIQALTILIWTSSALHASVNFGQYAYAAYPPNRPTLCRKFIPDEGTQEFAELLIDSDKYYLKMLPERFAITLSTALVEVLSRHTSDEVYLGQRQSSEWTDDQEVLRKFEEFGEKLKEIEQKIAERNRNARLKNRWGPAKIAYKLMHPDTSNVKNDGGITGKGIPNSISI
ccccccccccHHHcccccEEEEEEEEEcccEEEEccEEEECcccccccccccEEEEEEEccccccccccccccccEEcccccccccccccCEEEEEEEEEcccccccCEEEEEEcccccEEEEEEEEEcccccCEEEEEcccccccccccccEEEECccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccccHHHHHHHccccEEEccccccccccccccccccccccEEEEEEEccccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHccccccccccHHccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccECcccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccc
**************CFSSVQSAITSHAQANHAIIKGKIVIDHSPGQSGPGKSASVQIFSCTKVDPGTGKGKLSHIAYLKNGKSHKHNGTKTTTYKLKFYVEPDFGNPGAFVIENQHKYKFFLQAATLHAPDNQAIHFDCRSWVYPIKLTKTPRIFFSNKSYLPSETPSTLKDLRKQELISL****TGERKEWERIYDYDYYNDLGDPDIGPENARPVLGGSESLPYPRRGRTGRPKCRADLS*ESRPEKINLDIYVPPDERFSPKKLSEFIGNSIRASLHFLIPEANSLLEKDPHFRSFDEIRGMFSSNKSRKVEGWLTKKLQKLLPEQLFKQITRASKGDPMRFPEPQIIANNDLAWKEDEEFGRQMLAGINPTRIRCLEAFPPKGKNGKMSSITLADIEGSLDGLDITQAMNQWRIYILDHHDYLMPFLSRINTSSVCAYASRTLLFLRSDATLKPVAIELSLPSISSDEVNRVFLPAKEGIEAALWQLAKAHVLANDSAYHQLVTHWLHTHAVVEPFVIATRRQLSVMHPVHRLLDPHFKDTMHVNALARSILLNAGGILEKTLFPGKICMELSSELYKEWRFDEQALPKDLIKRRLALEDSDLPTGCQILFQDYPYGLDGLDVWLAIMTWVKDYCSIFYKDDDSVKSDEEIQAWWKEIREVGHGDKRNASWWFEMNSRDNLIQALTILIWTSSALHASVNFGQYAYAAYPPNRPTLCRKFIPDEGTQEFAELLIDSDKYYLKMLPERFAITLSTALVEVLSRHTSDEVYLGQRQSSEWTDDQEVLRKFEEFGEKLKEIEQKIAERNRNARLKNRWGPAKIAYKLMHPDTSNVKNDGGITGKGIPNSISI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMQHRGLRSDLQACFSSVQSAITSHAQANHAIIKGKIVIDHSPGQSGPGKSASVQIFSCTKVDPGTGKGKLSHIAYLKNGKSHKHNGTKTTTYKLKFYVEPDFGNPGAFVIENQHKYKFFLQAATLHAPDNQAIHFDCRSWVYPIKLTKTPRIFFSNKSYLPSETPSTLKDLRKQELISLRGDGTGERKEWERIYDYDYYNDLGDPDIGPENARPVLGGSESLPYPRRGRTGRPKCRADLSTESRPEKINLDIYVPPDERFSPKKLSEFIGNSIRASLHFLIPEANSLLEKDPHFRSFDEIRGMFSSNKSRKVEGWLTKKLQKLLPEQLFKQITRASKGDPMRFPEPQIIANNDLAWKEDEEFGRQMLAGINPTRIRCLEAFPPKGKNGKMSSITLADIEGSLDGLDITQAMNQWRIYILDHHDYLMPFLSRINTSSVCAYASRTLLFLRSDATLKPVAIELSLPSISSDEVNRVFLPAKEGIEAALWQLAKAHVLANDSAYHQLVTHWLHTHAVVEPFVIATRRQLSVMHPVHRLLDPHFKDTMHVNALARSILLNAGGILEKTLFPGKICMELSSELYKEWRFDEQALPKDLIKRRLALEDSDLPTGCQILFQDYPYGLDGLDVWLAIMTWVKDYCSIFYKDDDSVKSDEEIQAWWKEIREVGHGDKRNASWWFEMNSRDNLIQALTILIWTSSALHASVNFGQYAYAAYPPNRPTLCRKFIPDEGTQEFAELLIDSDKYYLKMLPERFAITLSTALVEVLSRHTSDEVYLGQRQSSEWTDDQEVLRKxxxxxxxxxxxxxxxxxxxxxARLKNRWGPAKIAYKLMHPDTSNVKNDGGITGKGIPNSISI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Linoleate 9S-lipoxygenase A Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. It catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure.probableP38415
Linoleate 9S-lipoxygenase 5, chloroplastic 9S-lipoxygenase that can use linoleic acid or linolenic acid as substrates. Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Function as regulators of root development by controlling the emergence of lateral roots.probableQ9LUW0
Linoleate 9S-lipoxygenase 6 (Fragment) Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Linoleic and linolenic acids are the preferred substrates, but is also active with arachidonic acid. The products are almost exclusively the S enantiomers.probableQ41238

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.11.-With incorporation of two atoms of oxygen.probable
1.13.11.12Transferred entry: 1.13.11.12.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IUK, chain A
Confidence level:very confident
Coverage over the Query: 41-853
View the alignment between query and template
View the model in PyMOL