Citrus Sinensis ID: 003097
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 848 | ||||||
| 359477127 | 927 | PREDICTED: calmodulin-binding transcript | 0.987 | 0.902 | 0.649 | 0.0 | |
| 224108659 | 915 | predicted protein [Populus trichocarpa] | 0.972 | 0.901 | 0.680 | 0.0 | |
| 356519932 | 920 | PREDICTED: calmodulin-binding transcript | 0.979 | 0.903 | 0.638 | 0.0 | |
| 255556328 | 918 | calmodulin-binding transcription activat | 0.977 | 0.903 | 0.654 | 0.0 | |
| 147834981 | 907 | hypothetical protein VITISV_010763 [Viti | 0.963 | 0.900 | 0.626 | 0.0 | |
| 357478931 | 920 | Calmodulin-binding transcription activat | 0.978 | 0.902 | 0.635 | 0.0 | |
| 356564630 | 921 | PREDICTED: calmodulin-binding transcript | 0.977 | 0.900 | 0.636 | 0.0 | |
| 449501552 | 910 | PREDICTED: LOW QUALITY PROTEIN: calmodul | 0.966 | 0.901 | 0.619 | 0.0 | |
| 356558139 | 911 | PREDICTED: calmodulin-binding transcript | 0.945 | 0.880 | 0.640 | 0.0 | |
| 357449029 | 953 | Calmodulin-binding transcription activat | 0.950 | 0.845 | 0.618 | 0.0 |
| >gi|359477127|ref|XP_002272118.2| PREDICTED: calmodulin-binding transcription activator 5-like [Vitis vinifera] gi|296083270|emb|CBI22906.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1130 bits (2923), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 559/861 (64%), Positives = 678/861 (78%), Gaps = 24/861 (2%)
Query: 1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
MLRNFRKDGHNWKKK DGKTVKEAHEHLKVGN+ERIHVYYAHG+D+PTFVRRCYWLLDKT
Sbjct: 74 MLRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQDNPTFVRRCYWLLDKT 133
Query: 61 LENIVLVHYRETHE--GTPATPPNSH---SSSISDQSAPLLLSEEFNSGAGHAYSAGGKE 115
LE+IVLVHYRET E G+P TP NS +S+ SD SAP LLSEE +SG G Y AG KE
Sbjct: 134 LEHIVLVHYRETQESQGSPVTPVNSSPSPNSATSDPSAPWLLSEETDSGTGSTYRAGEKE 193
Query: 116 LQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAA 175
Q P +S+TV+N+EMR+HELNTLEWD+L+V+ND N+S P+ K S F+QQN I +
Sbjct: 194 HQEPRDSITVRNYEMRIHELNTLEWDELLVSNDPNNSMAPKEGKISSFEQQNQHVITSSN 253
Query: 176 SNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEF 235
S ++D +S L + ++ I + + FN LD VY + +G Q + + QR +
Sbjct: 254 SYNRPHSTNDLPVGISP---LGNPAESIAGNESAHFNFLDDVYFQKIGGQVNPNGQRRDS 310
Query: 236 GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVL----------EPSISSG 285
V TGD +DIL D L+ QDSFG+WMNYIMTDSP SVDDP L S +
Sbjct: 311 VAVGTGDPVDILLKDSLEPQDSFGRWMNYIMTDSPVSVDDPSLGSPVSSSHDSVVSAAGN 370
Query: 286 HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEF 345
H Q +VP+ +FSITD SP+WA S EKTKILV GF H++ L+KSN+F VCG+V VPAE
Sbjct: 371 HQQSSVPDTIFSITDFSPSWAISTEKTKILVIGFLHENYADLAKSNLFFVCGDVCVPAEI 430
Query: 346 VQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQ 405
+Q GV+RC +PPH+PGL Y+S DGHKPISQV+ FEYR+P L+ SSE ++ WEEFQ
Sbjct: 431 IQLGVFRCLVPPHAPGLVNFYLSFDGHKPISQVVTFEYRAPLLYNQTVSSEVETNWEEFQ 490
Query: 406 VQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLP 465
QMRL+HLLFS+ KGLNI+SSK+ PN+L+EAK F K++ I+ +WA L K++GD R +
Sbjct: 491 FQMRLSHLLFSTSKGLNIMSSKISPNALREAKNFVKKTSFIARNWANLTKTIGDNRILVS 550
Query: 466 EAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGL 525
+AKD FE L +KL+EWL+ER+VEG KT+E D GQGVIHLCAMLGYT A+ L+S SGL
Sbjct: 551 QAKDLLFEFALLNKLQEWLVERIVEGGKTSERDGQGQGVIHLCAMLGYTRAVYLYSLSGL 610
Query: 526 SLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGF 585
SLD+RDK+GWTALHWAAYYGR+KMV LLSAGAKPNLVTDPTS+NPGG AAD+ASK+G
Sbjct: 611 SLDYRDKFGWTALHWAAYYGRQKMVAVLLSAGAKPNLVTDPTSENPGGCTAADLASKEGH 670
Query: 586 DGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAA 645
DGLAA+L+E+ LV QFNDMTLAGN+SGSLQ +T ++++NL+E+E+ LKDTL+AYRTAA
Sbjct: 671 DGLAAYLAEKGLVEQFNDMTLAGNVSGSLQVSTTEQINSENLSEEEMNLKDTLAAYRTAA 730
Query: 646 EAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQ 705
+AAARIQ AFRE SLK++TKA+ +PE EA+NI+AA++IQHAFRN+E RK+MAAAARIQ
Sbjct: 731 DAAARIQVAFRERSLKLRTKAVENCNPEIEARNIVAAMRIQHAFRNYETRKRMAAAARIQ 790
Query: 706 HRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFR 765
HRFRSWK+RKEFLNMRRQAIKIQA FRGFQVR+QY KILWSVGVLEK ILRWR+KRKGFR
Sbjct: 791 HRFRSWKIRKEFLNMRRQAIKIQAVFRGFQVRRQYRKILWSVGVLEKVILRWRMKRKGFR 850
Query: 766 GLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRM 825
GLQVD V D E D EEDF+RASR+QAE+RVERSV+RVQ+MFRSKKAQEEYRRM
Sbjct: 851 GLQVDTV------DQLQESDTEEDFFRASRRQAEDRVERSVIRVQAMFRSKKAQEEYRRM 904
Query: 826 KLAHDQAKLEYEGLLDPDMEM 846
KLAH++AKLE+EG +DPD M
Sbjct: 905 KLAHNEAKLEFEGFIDPDTNM 925
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224108659|ref|XP_002314926.1| predicted protein [Populus trichocarpa] gi|222863966|gb|EEF01097.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356519932|ref|XP_003528622.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255556328|ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147834981|emb|CAN70197.1| hypothetical protein VITISV_010763 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357478931|ref|XP_003609751.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355510806|gb|AES91948.1| Calmodulin-binding transcription activator [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356564630|ref|XP_003550554.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449501552|ref|XP_004161401.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-binding transcription activator 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356558139|ref|XP_003547365.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357449029|ref|XP_003594790.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355483838|gb|AES65041.1| Calmodulin-binding transcription activator [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 848 | ||||||
| TAIR|locus:2130125 | 923 | AT4G16150 [Arabidopsis thalian | 0.979 | 0.900 | 0.566 | 3.8e-259 | |
| TAIR|locus:2060405 | 1032 | SR1 "signal responsive 1" [Ara | 0.641 | 0.527 | 0.321 | 1.7e-98 | |
| TAIR|locus:2019534 | 1016 | AT1G67310 [Arabidopsis thalian | 0.620 | 0.517 | 0.329 | 8.5e-94 | |
| TAIR|locus:2173368 | 1050 | AT5G64220 [Arabidopsis thalian | 0.759 | 0.613 | 0.284 | 1.2e-89 | |
| UNIPROTKB|J9NZ90 | 1214 | CAMTA2 "Uncharacterized protei | 0.074 | 0.051 | 0.553 | 1.3e-27 | |
| UNIPROTKB|F1RFY4 | 1201 | CAMTA2 "Uncharacterized protei | 0.074 | 0.052 | 0.553 | 1.6e-27 | |
| UNIPROTKB|Q9Y6Y1 | 1673 | CAMTA1 "Calmodulin-binding tra | 0.074 | 0.037 | 0.553 | 2.4e-27 | |
| UNIPROTKB|E1BH04 | 1196 | Bt.24734 "Uncharacterized prot | 0.074 | 0.052 | 0.553 | 2.5e-27 | |
| UNIPROTKB|F1PDC5 | 1596 | CAMTA1 "Uncharacterized protei | 0.074 | 0.039 | 0.553 | 4.9e-27 | |
| UNIPROTKB|O94983 | 1202 | CAMTA2 "Calmodulin-binding tra | 0.074 | 0.052 | 0.553 | 1.4e-26 |
| TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2494 (883.0 bits), Expect = 3.8e-259, P = 3.8e-259
Identities = 488/862 (56%), Positives = 624/862 (72%)
Query: 1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
MLRNFRKDGHNWKKKKDGKT+KEAHEHLKVGNEERIHVYYAHGED+PTFVRRCYWLLDK+
Sbjct: 74 MLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLLDKS 133
Query: 61 LENIVLVHYRETHE--GTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQA 118
E+IVLVHYRETHE PATP NS+SSSI+D +P +++E+ +SG + + G +
Sbjct: 134 QEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGVHNTCNTG---FEV 190
Query: 119 PNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNG 178
+ SL +NHE+RLHE+NTL+WD+L+V D ++ + P + +F +Q TA +G+ G
Sbjct: 191 RSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRGSVKQG 250
Query: 179 SFFPSHDSYAEVSSGGCLTSLSQPIDRSNNT-QFNNLDGVYSELMGTQSSVSSQRNEFGE 237
+ ++ ++ S L P+ ++NN+ +S G ++ QR +F
Sbjct: 251 NHLAGYNGSVDIPS---FPGLEDPVYQNNNSCGAGEFSSQHSHC-GVDPNL--QRRDFSA 304
Query: 238 VCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG----------HH 287
T D L +G SQDSFG+W+N ++DSPGSVDDP LE + G H
Sbjct: 305 TVTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPTVFHS 364
Query: 288 QFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQ 347
+PE +F+ITDVSPAWA+S EKTKILVTGFFH HL +SN+ C+CGE+RVPAEF+Q
Sbjct: 365 HSDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPAEFLQ 424
Query: 348 AGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKS-KWEEFQV 406
GVYRCFLPP SPG+ LY+S+DG+KPISQ+ +FE+RS Q +D+ KWEEF+
Sbjct: 425 MGVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWEEFEF 484
Query: 407 QMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPE 466
Q+RLAHLLF+S +++L+SK+ P +L EAKK AS+++ + NSWAYL KS+ +
Sbjct: 485 QVRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEVPFDQ 544
Query: 467 AKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLS 526
A+D FELTLK++LKEWLLE+V+E T EYD G GVIHLCA+LGYTW+ILLFSW+ +S
Sbjct: 545 ARDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSWANIS 604
Query: 527 LDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFD 586
LDFRDK GWTALHWAAYYGREKMV LLSAGA+PNLVTDPT + GG AAD+A +KG+D
Sbjct: 605 LDFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQKGYD 664
Query: 587 GLAAFLSEQALVAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSXXXXXX 645
GLAAFL+E+ LVAQF DM AGNISG+L+T + + + N E+E LKDTL+
Sbjct: 665 GLAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAYRTAA 724
Query: 646 XXXXXXXXXXXEHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQ 705
EH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAAARIQ
Sbjct: 725 EAAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAAARIQ 784
Query: 706 HRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFR 765
+RF++WK+R+EFLNMR++AI+IQAAFRGFQVR+QY KI WSVGVLEKAILRWRLKRKGFR
Sbjct: 785 YRFQTWKMRREFLNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKRKGFR 844
Query: 766 GLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAXXXXXXXXXXXQSMFRSKKAQEEYRRM 825
GLQV + D +A EDFY+ S+KQA Q+MFRSKKAQ++YRRM
Sbjct: 845 GLQVSQ------PDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRM 898
Query: 826 KLAHDQAKLEYEGLLDPDMEMA 847
KLAH++A+LEY+G+ + D +MA
Sbjct: 899 KLAHEEAQLEYDGMQELD-QMA 919
|
|
| TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDC5 CAMTA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033115001 | SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (869 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 848 | |||
| pfam03859 | 119 | pfam03859, CG-1, CG-1 domain | 1e-41 | |
| smart01076 | 118 | smart01076, CG-1, CG-1 domains are highly conserve | 1e-37 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-13 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-08 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 1e-07 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-07 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 6e-07 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 3e-06 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 6e-06 | |
| pfam01833 | 84 | pfam01833, TIG, IPT/TIG domain | 7e-06 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 2e-05 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 5e-05 | |
| smart00015 | 23 | smart00015, IQ, Calmodulin-binding motif | 9e-05 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-04 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 1e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-04 | |
| pfam00612 | 21 | pfam00612, IQ, IQ calmodulin-binding motif | 5e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 6e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 0.002 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.003 |
| >gnl|CDD|217766 pfam03859, CG-1, CG-1 domain | Back alignment and domain information |
|---|
Score = 147 bits (374), Expect = 1e-41
Identities = 51/73 (69%), Positives = 60/73 (82%)
Query: 1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
++R FRKDG+NWKKKKDGKT +EAHE LKVG E ++ YYAHGED+PTF RRCYWLLD+
Sbjct: 47 VVRYFRKDGYNWKKKKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDED 106
Query: 61 LENIVLVHYRETH 73
LE+IVLVHY
Sbjct: 107 LEHIVLVHYLNVK 119
|
CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119 |
| >gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PF03859 | 118 | CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.86 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.82 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.75 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.75 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.73 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.72 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.72 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.71 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.71 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.7 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.7 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.7 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.69 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.68 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.68 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.67 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.66 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.66 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.66 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.65 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.64 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.64 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.64 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.64 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.64 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.64 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.63 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.63 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.63 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.62 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.61 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.61 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.61 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.61 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.6 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.6 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.6 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.59 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.59 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.58 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.58 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.56 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.54 | |
| cd01175 | 85 | IPT_COE IPT domain of the COE family (Col/Olf-1/EB | 99.52 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.51 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.51 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.51 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.51 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.51 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.51 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.5 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.48 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.48 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.48 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.48 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.47 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.46 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.43 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.43 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.43 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.43 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 99.41 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.4 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.39 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.38 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.35 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.35 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.32 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.31 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.3 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.28 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.28 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.28 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.28 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.27 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.25 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.23 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.21 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.16 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.16 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.15 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.14 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.14 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.08 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.06 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.05 | |
| PF01833 | 85 | TIG: IPT/TIG domain; InterPro: IPR002909 This fami | 99.0 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.94 | |
| cd01179 | 85 | IPT_plexin_repeat2 Second repeat of the IPT domain | 98.92 | |
| cd00102 | 89 | IPT Immunoglobulin-like fold, Plexins, Transcripti | 98.84 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.83 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.82 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.79 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.7 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.65 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.55 | |
| cd00603 | 90 | IPT_PCSR IPT domain of Plexins and Cell Surface Re | 98.51 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.48 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.47 | |
| cd01180 | 94 | IPT_plexin_repeat1 First repeat of the IPT domain | 98.44 | |
| smart00429 | 90 | IPT ig-like, plexins, transcription factors. | 98.41 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.3 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.29 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.28 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 98.23 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.22 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.22 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.22 | |
| cd01181 | 99 | IPT_plexin_repeat3 Third repeat of the IPT domain | 98.2 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.19 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.17 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.16 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.16 | |
| cd02849 | 81 | CGTase_C_term Cgtase (cyclodextrin glycosyltransfe | 98.13 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.01 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.99 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 97.87 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.82 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.81 | |
| cd00604 | 81 | IPT_CGTD IPT domain (domain D) of cyclodextrin gly | 97.72 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.61 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.58 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.43 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.34 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 96.98 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.96 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 96.76 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 96.6 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.48 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.45 | |
| KOG3836 | 605 | consensus HLH transcription factor EBF/Olf-1 and r | 96.32 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.13 | |
| cd00602 | 101 | IPT_TF IPT domain of eukaryotic transcription fact | 95.97 | |
| cd01178 | 101 | IPT_NFAT IPT domain of the NFAT family of transcri | 95.93 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.92 | |
| cd01176 | 97 | IPT_RBP-Jkappa IPT domain of the recombination sig | 95.7 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.56 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 95.29 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 95.23 | |
| KOG3610 | 1025 | consensus Plexins (functional semaphorin receptors | 95.13 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 94.97 | |
| PTZ00014 | 821 | myosin-A; Provisional | 94.93 | |
| cd01177 | 102 | IPT_NFkappaB IPT domain of the transcription facto | 94.85 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 94.63 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 93.95 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 93.48 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 90.25 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 84.99 |
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-114 Score=1008.74 Aligned_cols=807 Identities=42% Similarity=0.635 Sum_probs=601.7
Q ss_pred CcccccccCccccccCCCcchHHhhhhhccCCeeeEEEeeeccCCCCCcceeeeeeccCCCCceEEEEeeecCCCCCCC-
Q 003097 1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPAT- 79 (848)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~- 79 (848)
||||||||||+|||||||||||||||||||||+|+||||||||+++|||||||||||+++++||||||||||++..-+.
T Consensus 74 ~lr~fRKDGh~WkKkkDGKtirEaHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~~~ 153 (975)
T KOG0520|consen 74 VLRYFRKDGHNWKKKKDGKTIREAHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDAAK 153 (975)
T ss_pred HHHHHhhcchhhhhcCCCCcChHHHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeeccccccccc
Confidence 6899999999999999999999999999999999999999999999999999999999999999999999999944332
Q ss_pred -CCCCCCCCCCCCCccccccccccCCCCCcc---c-----------cCcccccCCCCCccccccccccccccccc-cccc
Q 003097 80 -PPNSHSSSISDQSAPLLLSEEFNSGAGHAY---S-----------AGGKELQAPNESLTVQNHEMRLHELNTLE-WDDL 143 (848)
Q Consensus 80 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~ 143 (848)
+.....+.++|.- ++..+.+.+..++.. + +....++.-.+ ...+|..+++..+..+ |..+
T Consensus 154 ~~~~~~~s~~sd~~--~S~~~~~~q~~~~~~~~~s~~~~v~~i~s~~~~~~~g~~~~--~s~~h~i~~~~~~s~~~~~~~ 229 (975)
T KOG0520|consen 154 GAGEIFSSIISDKA--WSLNQLAGQLSPIFHNHSSVNEDVAEINSNQTGNALGSVFG--NSRNHRIRLHEVNSLDPLYKL 229 (975)
T ss_pred Cccccccccccccc--ccHHHhhcccCcchhcccchHHHHHHHhhhccccccccccC--cchhhhhcccccCCccccccc
Confidence 1112223444443 333333322222111 0 11111111001 2358999999999999 9999
Q ss_pred cccCCCCCCCCCCCCCC--------------ccccccccccccCCCCCCCCCCCCCC-ccccccCCCCCCCCCC-ccCCC
Q 003097 144 VVTNDSNDSTEPRGDKF--------------SHFDQQNHTAIKGAASNGSFFPSHDS-YAEVSSGGCLTSLSQP-IDRSN 207 (848)
Q Consensus 144 ~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~~~~~ 207 (848)
.++.++.+...|.-... .++.....+..+++..- ..+..+ +..|.+ +..+..+ +..++
T Consensus 230 p~s~~s~~~~~~~~~~~~~~~~~~~~rs~~~s~~te~l~n~~~~~~~~---g~s~s~~l~~i~~---~~~~~~~~~~~p~ 303 (975)
T KOG0520|consen 230 PVSDDSLNLSAPKPIDLPKGPTSVKQRSSSPSYFTEILGNAPSGLVSQ---GNSLSSSLQRISS---FTGLDNAAYEQPN 303 (975)
T ss_pred cccCCccccccCCCcccccCCcchhhcCCCCcchhhhcccCCCccccc---ccccccchhhccc---ccccccccccCCc
Confidence 99988644443322111 11111111111110000 000000 000100 0000000 00000
Q ss_pred CccccCCccchhhccCCccc---ccccccccccccCCCc----cc-chhcCCCCCCCchhhhhHHhhcCCCC--------
Q 003097 208 NTQFNNLDGVYSELMGTQSS---VSSQRNEFGEVCTGDS----LD-ILAGDGLQSQDSFGKWMNYIMTDSPG-------- 271 (848)
Q Consensus 208 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~----~~-~~~~~~~~~~~sf~~~~~~~~~~s~~-------- 271 (848)
...|. ...+..-+..+. ...+...........+ .+ .+.++||++.|||++|++-+...+++
T Consensus 304 ~~nf~---~~ss~~s~~~~~~~g~g~~~~~~sa~~~~~P~~~~~~~~~~~~~l~sgdsf~~~~~t~~e~~d~~q~~s~~~ 380 (975)
T KOG0520|consen 304 SQNFE---PNSSLNSHVTGQSYGQGLQARSPSATSESRPITSAADAALSELGLKSGDSFSRWASTFGEISDLGQDPSGEA 380 (975)
T ss_pred ccccc---ccccCCCCccccccCccccCCCcccccccCCcchhhccccccccccccccccchhhhhcccccCCCCCcccc
Confidence 01110 000000000000 0011111111111111 22 46689999999999999986543322
Q ss_pred CCCCCCCCCCCCC--CCCCCCCCCCcceeEEeccCCccCCCCeEEEEECcCCCCcccCCCcceEEEcCCeecceeeeeCC
Q 003097 272 SVDDPVLEPSISS--GHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAG 349 (848)
Q Consensus 272 ~~~~~~~~~~~~~--~~~~s~~~~~~~~I~d~sP~w~~~~gg~kVlv~G~~~~~~~~~~~~~~~c~FG~~~vpa~~~~~g 349 (848)
.|.. ...+.+.. ..++| .++|+|+|+||||+|+|++||+||+|+|++. +....+|+||||+++|||++|++|
T Consensus 381 ~~~p-~~~~~~~~~s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~~----~~~~~~ysc~Fg~~~VPAeliq~G 454 (975)
T KOG0520|consen 381 VWTP-ENDPMGPPGSFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFPQ----DETRSNYSCMFGEQRVPAELIQEG 454 (975)
T ss_pred cccc-CCCcCCCcccccCCC-CCcceeeeeccCcccccCCCCcEEEEecCcc----ccCCCceEEEeCCccccHHHhhcc
Confidence 1211 11111111 34445 4499999999999999999999999999743 235889999999999999999999
Q ss_pred eeeeecCCCCCceeEEEEEeC-CCCCcccccccccCCCC--CccCCCCccccchhhHHHHHHHHHHHHhccccccccccC
Q 003097 350 VYRCFLPPHSPGLFLLYMSLD-GHKPISQVLNFEYRSPQ--LHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSS 426 (848)
Q Consensus 350 vl~C~~Pph~~G~Vpl~v~~~-~~~~~Sev~~Fey~~~~--~~~~~~~~~~~~~~~e~~l~~Rl~~LL~~~~~~l~il~~ 426 (848)
|||||||||+||.|+|||+|+ ++..|||+++|+|...+ .+++.+ -++...++.++.||..|+... .+++++
T Consensus 455 VLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s---~~d~~~~~sl~~rl~~~~~r~---~~~~~s 528 (975)
T KOG0520|consen 455 VLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLS---WEDFLFQMSLLHRLETMLNRK---QSILSS 528 (975)
T ss_pred eeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccc---cccchhhhHHHHHHHHHHHHh---HhHhhc
Confidence 999999999999999999999 88999999999999843 344433 123456777888888887643 245666
Q ss_pred CCCCCChHHHHH--HhhhhhcCCCCHHH-HHHHhCCCCCCcccccchHHHHHHcCCcHHHHHHHHHc--CCCCccccCCC
Q 003097 427 KVPPNSLKEAKK--FASKSTCISNSWAY-LFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVE--GSKTTEYDVHG 501 (848)
Q Consensus 427 k~~~~~l~e~~~--~~~~i~~~~~~~~~-l~~~l~~~~~~~~~~~~~Ll~aa~~~~l~e~L~~~L~~--Ga~in~~D~~G 501 (848)
+..+.+..++.. ++.+++...+.|.+ ++.....+.......++.++.-.++..+..||++.+++ |......|.+|
T Consensus 529 ~~~~~n~~~~~~~~l~skv~~l~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~eld~d~ 608 (975)
T KOG0520|consen 529 KPSTENTSDAESGNLASKVVHLLNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDLELDRDG 608 (975)
T ss_pred cCCccccccccchhHHHHHHHHHHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCchhhcccC
Confidence 777777777777 88899988999999 88888888888888888888888888889999999999 55666799999
Q ss_pred CchHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHH
Q 003097 502 QGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIAS 581 (848)
Q Consensus 502 ~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~TpLh~Aa~~G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~ 581 (848)
+..+|++|..|+.+.+.+.++.|..++++|..||||||||+.+|++.++..|++.|++.+++|||+..+..|.|+.++|.
T Consensus 609 qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~ta~~la~ 688 (975)
T KOG0520|consen 609 QGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKTAADLAR 688 (975)
T ss_pred CChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCchhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HcCChHHHHHHHhhhhhhccccccccc-cccCcccccccccc-ccc--CccchhhhhhhhhhHHhhhHHHHHHHHHHHhh
Q 003097 582 KKGFDGLAAFLSEQALVAQFNDMTLAG-NISGSLQTGSTITV-DTQ--NLTEDEVYLKDTLSAYRTAAEAAARIQAAFRE 657 (848)
Q Consensus 582 ~~G~~~iv~~Ll~~Ga~~~~~~~~l~~-~is~~~~~~~~~~~-~~~--~~~~~~lsl~~sL~a~r~~~~AA~~IQ~~~R~ 657 (848)
.+||.++..+|.++.+..++.++.+.+ ++++.......... .+. +...+..+++++|.++|++++||.+||++||+
T Consensus 689 s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~~~t~~e~s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~ 768 (975)
T KOG0520|consen 689 ANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKAEKTSSEGSPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRA 768 (975)
T ss_pred cccccchHHHHhhhHHHHHHhhccccccccCCCchhhhhhhccCCCCCCCCccccccccccccccchHHHHHhhhhhhhh
Confidence 999999999999999999999999988 55555444433322 222 22344556999999999999999999999999
Q ss_pred hHHHHHHHHhh-cCChHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Q 003097 658 HSLKVQTKAIR-FSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQV 736 (848)
Q Consensus 658 ~~~Rkr~~~~~-~~~~~~~~~~~~Aa~~IQ~~~R~~~~r~~~~aA~~IQ~~~Rg~~~Rk~f~~~r~aai~IQa~~Rg~~~ 736 (848)
..++++..+.. ......-.......++++..++++..|....+|..||.+||+|+.|+.|...|+.+++||+++||++.
T Consensus 769 ~~~~~~~a~~i~~~~~~~i~~~~~~~m~~~~a~~~~~~r~~~~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~ 848 (975)
T KOG0520|consen 769 QSFQKKQAREIMDATKEQISEELAVSMKASSAFSMCDDRSDPAAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQV 848 (975)
T ss_pred hhhhhhhHHHHHhhcchhhhhhhhhhhhcccchhcCccccchhHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhH
Confidence 99986654432 22334555666777889999987777777889999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccCCCCCC---chhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 003097 737 RKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHE---GDAEEDFYRASRKQAEERVERSVVRVQSMF 813 (848)
Q Consensus 737 Rk~y~~~~~aa~~IQ~~~R~~r~~rk~~r~lr~~~~~~~~~~~q~q~---~~~~~~~l~~~Rkq~~~~~~~AvirIQs~~ 813 (848)
|+.|+++.|++.++.+.+.+||+.++.+|+|+.++... .|..+ .++++++|+..|++.++++.+|+++||+|+
T Consensus 849 r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e----~~~~a~t~~e~~yd~yKq~~~~~~~r~~~A~~~VQsm~ 924 (975)
T KOG0520|consen 849 RKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFE----EQETAATVIEDCYDFYKQLRKQTEERLTRAVVRVQSMF 924 (975)
T ss_pred hhhhheechhhhHHHHHHHHHHHhhhhhcccccccchh----ccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999887531 11111 169999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHH
Q 003097 814 RSKKAQEEYRRMKLAHDQAKLEY 836 (848)
Q Consensus 814 R~~~aRr~~~~lk~~~~~ak~e~ 836 (848)
|.+++|.+|+|++...++.++.+
T Consensus 925 rs~~a~qqyrR~~~~~~~~~~~~ 947 (975)
T KOG0520|consen 925 RSPKAQQQYRRLLLVYEQYQESY 947 (975)
T ss_pred cCHHHHHHHHHHHHHHHHHHhhh
Confidence 99999999999999999988865
|
|
| >PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >smart00429 IPT ig-like, plexins, transcription factors | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and recombination signal J-kappa binding protein (RBP-Jkappa) | Back alignment and domain information |
|---|
| >cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa) | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 848 | ||||
| 2cxk_A | 95 | Crystal Structure Of The Tig Domain Of Human Calmod | 6e-10 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-05 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-04 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 1e-04 | ||
| 2ix7_C | 58 | Structure Of Apo-Calmodulin Bound To Unconventional | 2e-04 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 3e-04 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-04 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-04 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 3e-04 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 4e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 5e-04 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 5e-04 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 5e-04 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 6e-04 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 6e-04 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 6e-04 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 7e-04 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-04 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 9e-04 |
| >pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 | Back alignment and structure |
|
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2IX7|C Chain C, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 58 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 848 | |||
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 2e-31 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 1e-15 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 5e-07 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 4e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-12 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 3e-10 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 4e-05 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-09 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-06 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-06 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-09 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-05 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-09 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-08 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-07 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-06 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-05 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 4e-09 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-07 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-06 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-09 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-05 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-04 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 8e-09 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-06 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-05 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 4e-04 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-08 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-07 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-08 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-06 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 9e-06 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-05 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-04 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-04 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-04 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-08 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-07 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 6e-07 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 5e-06 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-08 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 3e-08 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-07 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 6e-05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-08 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-08 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-08 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-04 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-07 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-07 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-08 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-07 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-06 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-08 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 5e-08 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-07 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 8e-07 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-04 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 5e-08 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-07 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 7e-07 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-06 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-05 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 5e-05 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-08 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-07 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-06 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 8e-06 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-05 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-05 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-05 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-05 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 7e-08 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-07 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-07 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 8e-04 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 7e-08 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-07 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-07 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 8e-07 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-06 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-06 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 7e-08 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-07 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-06 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-06 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-05 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 9e-08 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 9e-08 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-06 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-06 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 9e-06 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-07 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-07 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 8e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-06 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-06 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 9e-06 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-07 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-06 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-06 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 8e-06 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-05 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-07 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-07 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-06 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-06 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-06 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-05 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-07 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-06 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-06 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 8e-05 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-07 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 4e-06 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-05 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-07 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-07 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 6e-07 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-04 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-07 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-06 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-05 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-05 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-04 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-07 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-07 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 8e-07 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-06 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-06 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-06 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-05 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-07 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-07 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 9e-07 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-06 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 5e-05 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-07 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-06 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-06 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-06 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-06 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-05 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 5e-05 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-04 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 3e-07 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-06 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-06 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 4e-04 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-06 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 6e-06 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 6e-06 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-07 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 5e-07 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-07 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 9e-07 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-06 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-06 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 9e-06 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 4e-07 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 4e-07 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-06 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 4e-05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-04 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 9e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-06 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-06 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-05 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-05 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-04 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 7e-07 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-07 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-06 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-06 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-05 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-05 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-04 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 7e-07 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 8e-07 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-06 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-04 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 7e-07 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-06 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-06 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-04 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-04 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 8e-07 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-06 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 4e-06 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-05 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-04 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 9e-07 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-06 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-06 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-04 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-04 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-04 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-06 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-06 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-06 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-05 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-05 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-04 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-06 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 9e-06 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 9e-04 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-05 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 8e-06 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-05 | |
| 3muj_A | 138 | Transcription factor COE3; immunoglobulin like fol | 2e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 3e-05 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 8e-05 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-04 |
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 | Back alignment and structure |
|---|
Score = 116 bits (293), Expect = 2e-31
Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 6/92 (6%)
Query: 295 LFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCF 354
+TD SP W++ K+L+TG + + + +N C+ ++ VPA +Q GV RC+
Sbjct: 6 SGMVTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCY 60
Query: 355 LPPHSPGLFLLYMSLDGHKPISQVLNFEYRSP 386
P H GL L ++ + + IS + FEY+S
Sbjct: 61 CPAHDTGLVTLQVAFNN-QIISNSVVFEYKSG 91
|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.9 | |
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 99.89 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.88 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.85 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.84 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.84 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.83 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.83 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.82 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.82 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.82 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.82 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.82 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.82 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.82 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.81 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.81 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.81 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.81 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.8 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.8 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.8 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.8 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.8 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.8 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.8 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.8 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.79 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.79 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.79 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.79 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.79 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.79 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.78 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.78 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.78 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.78 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.78 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.78 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.78 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.78 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.77 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.77 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.77 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.77 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.77 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.77 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.77 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.77 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.77 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.77 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.77 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.77 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.77 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.77 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.76 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.76 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.76 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.76 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.76 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.76 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.76 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.76 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.76 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.75 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.75 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.75 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.75 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.75 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.75 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.75 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.75 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.74 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.74 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.74 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.74 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.74 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.74 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.73 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.73 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.73 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.73 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.73 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.73 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.73 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.73 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.72 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.72 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.72 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.72 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.72 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.71 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.71 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.71 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.7 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.69 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.69 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.69 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.68 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.68 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.67 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.66 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.66 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.66 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.65 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.65 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.62 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.61 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.6 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.59 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.55 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.47 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.46 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.45 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.45 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.44 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.43 | |
| 3muj_A | 138 | Transcription factor COE3; immunoglobulin like fol | 98.91 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.85 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.64 | |
| 3mlp_A | 402 | Transcription factor COE1; transcription factor, p | 98.56 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.48 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.33 | |
| 1uad_C | 99 | RSEC5, exocyst complex component SEC5; small GTP-b | 97.96 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 97.69 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.53 | |
| 2uzx_B | 727 | Hepatocyte growth factor receptor; signaling prote | 97.5 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 97.29 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 97.23 | |
| 2uzx_B | 727 | Hepatocyte growth factor receptor; signaling prote | 97.14 | |
| 2yrp_A | 114 | Nuclear factor of activated T-cells, cytoplasmic 4 | 96.99 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.98 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 96.98 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.92 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.87 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 96.71 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.6 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.59 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 95.91 | |
| 1ikn_C | 119 | P50D, protein (NF-kappa-B P50D subunit); transcrip | 95.51 | |
| 1my7_A | 114 | NF-kappab P65 (RELA) subunit; immunoglobulin, IG, | 94.87 | |
| 1u36_A | 106 | DNA-binding, nuclear factor NF-kappa-B P105 subuni | 94.81 | |
| 1oy3_C | 136 | Transcription factor P65; protein-protein complex, | 93.96 | |
| 1zk9_A | 110 | Transcription factor RELB; NF-KB, transcription fa | 93.74 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 92.07 | |
| 2v2t_A | 288 | RELB, transcription factor RELB; 4-diphosphocytidy | 91.51 | |
| 1a3q_A | 285 | Protein (nuclear factor kappa-B P52); transcriptio | 91.02 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 90.96 | |
| 1nfk_A | 325 | Protein (nuclear factor kappa-B (NF-KB)); NF-KB P5 | 90.96 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 90.9 | |
| 1ikn_A | 286 | P65, protein (NF-kappa-B P65 subunit); transcripti | 90.43 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 89.73 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 89.69 | |
| 1p7h_L | 286 | Nuclear factor of activated T-cells, cytoplasmic 2 | 89.64 | |
| 2o61_A | 540 | Transcription factor P65/interferon regulatory FA | 89.62 | |
| 3iag_C | 422 | Recombining binding protein suppressor of hairless | 89.24 | |
| 1svc_P | 365 | Protein (nuclear factor kappa-B (NF-KB)); DNA-bind | 89.15 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 88.76 | |
| 1imh_C | 281 | NF-AT5, tonebp, nuclear factor of activated T cell | 87.55 | |
| 1gji_A | 275 | C-REL protein, C-REL proto-oncogene protein; NF-KB | 86.93 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 84.54 | |
| 3orj_A | 439 | Sugar-binding protein; structural genomics, joint | 84.45 |
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
Probab=99.90 E-value=4.8e-23 Score=205.12 Aligned_cols=130 Identities=22% Similarity=0.279 Sum_probs=114.8
Q ss_pred cccccchHHHHHHcCCcHHHHHHHHHcCCCCccccCCCCchHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHHHH
Q 003097 464 LPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAY 543 (848)
Q Consensus 464 ~~~~~~~Ll~aa~~~~l~e~L~~~L~~Ga~in~~D~~G~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~TpLh~Aa~ 543 (848)
...+.++++.++..+... .+..++..|++++..|..|+||||+|+..|+.++|++|+++|+++|.+|..|+||||+|+.
T Consensus 34 d~~g~t~l~~a~~~~~~~-~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~ 112 (169)
T 4gpm_A 34 DSDGRTPLHHAAENGHKE-VVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAE 112 (169)
T ss_dssp CTTSCCHHHHHHHTTCHH-HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHH
T ss_pred CCCCCCHHHHHHHcCCHH-HHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHH
Confidence 456788999988888765 2333444499999999999999999999999999999999999999999999999999999
Q ss_pred cCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHHHcCChHHHHHHHhhhhhhc
Q 003097 544 YGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQ 600 (848)
Q Consensus 544 ~G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~~~G~~~iv~~Ll~~Ga~~~ 600 (848)
.|+.++|++|+++|++++. +|..|.||||+|+..|+.+++++|+++||+..
T Consensus 113 ~g~~~~v~~Ll~~gad~~~------~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~ie 163 (169)
T 4gpm_A 113 NGHKEVVKLLISKGADVNT------SDSDGRTPLDLAREHGNEEVVKLLEKQGGWLE 163 (169)
T ss_dssp TTCHHHHHHHHHTTCCTTC------CCTTSCCHHHHHHHTTCHHHHHHHHTC-----
T ss_pred cCCHHHHHHHHHcCCCccc------cCCCCCCHHHHHHHcCCHHHHHHHHHCCCCcC
Confidence 9999999999999999998 88999999999999999999999999999864
|
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uad_C RSEC5, exocyst complex component SEC5; small GTP-binding protein, immunogloblin-like fold, beta- sandwich, endocytosis/exocytosis complex; HET: GNP; 2.10A {Rattus norvegicus} SCOP: b.1.18.18 PDB: 1hk6_A | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A | Back alignment and structure |
|---|
| >2yrp_A Nuclear factor of activated T-cells, cytoplasmic 4; beta-sandwich, immunoglobulin-like fold, TIG domain, IPT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1ikn_C P50D, protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1 | Back alignment and structure |
|---|
| >1my7_A NF-kappab P65 (RELA) subunit; immunoglobulin, IG, beta-sandwich, beta-sheet, homodimerdna- binding, transcription regulation, activator; 1.49A {Mus musculus} SCOP: b.1.18.1 PDB: 1my5_A 1bft_A | Back alignment and structure |
|---|
| >1u36_A DNA-binding, nuclear factor NF-kappa-B P105 subunit; transcription factor, NF-KB, dimerization domain, intertwined folding; 1.89A {Mus musculus} SCOP: b.1.18.1 PDB: 1u3z_A 1u3y_A 3jv4_B 1bfs_A 1u3j_A 1u42_A 1u41_A 1nfi_B | Back alignment and structure |
|---|
| >1oy3_C Transcription factor P65; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: b.1.18.1 PDB: 1k3z_A | Back alignment and structure |
|---|
| >1zk9_A Transcription factor RELB; NF-KB, transcription factors, intertwined dimer; 2.18A {Mus musculus} PDB: 1zka_A 3jv6_A 3jv4_A 3jss_A 3juz_A 3jv0_A | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >2v2t_A RELB, transcription factor RELB; 4-diphosphocytidyl-2C-methyl-D-erythritol, aquifex aeolicus, nucleotide-binding, isoprene biosynthesis; 3.05A {Mus musculus} PDB: 3do7_A | Back alignment and structure |
|---|
| >1a3q_A Protein (nuclear factor kappa-B P52); transcription factor, immune response, DNA-protein complex, transcription/DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 3do7_B 3jv6_B 3jv5_A | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nfk_A Protein (nuclear factor kappa-B (NF-KB)); NF-KB P50, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 2v2t_B 1ooa_A 1lei_B* 1le9_B 1le5_B* 2i9t_B 1vkx_B* 3gut_B 2o61_B | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ikn_A P65, protein (NF-kappa-B P65 subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 1nfi_A 2ram_A* 1ram_A* 2i9t_A 1lei_A* 1le9_A 1le5_A* 1vkx_A* 3gut_A | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >1p7h_L Nuclear factor of activated T-cells, cytoplasmic 2; DNA binding protein, transcription regulation, activator, transcription/DNA complex; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 2o93_L 1a02_N* 1pzu_B 1owr_M 2as5_N 1s9k_C 3qrf_N 1nfa_A 1a66_A* | Back alignment and structure |
|---|
| >2o61_A Transcription factor P65/interferon regulatory FA 7/interferon regulatory factor...; protein-DNA complex, transcription-DNA complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3iag_C Recombining binding protein suppressor of hairless; protein-DNA complex, signaling, transcription, notch, activator, alternative splicing; HET: XYL; 2.00A {Mus musculus} PDB: 3brg_C* 3nbn_A 2f8x_C 3v79_C* | Back alignment and structure |
|---|
| >1svc_P Protein (nuclear factor kappa-B (NF-KB)); DNA-binding, transcription regulation, activator, nuclear protein, phosphorylation, repeat, DNA; HET: DNA; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1imh_C NF-AT5, tonebp, nuclear factor of activated T cells 5; beta barrel, protein-DNA complex, double helix, DNA encirclement, transcription/DNA complex; 2.86A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 | Back alignment and structure |
|---|
| >1gji_A C-REL protein, C-REL proto-oncogene protein; NF-KB/DNA complex, transcription factor, C-REL homodimer, transcription/DNA complex; 2.85A {Gallus gallus} SCOP: b.1.18.1 b.2.5.3 | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >3orj_A Sugar-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.16A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 848 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 8e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.001 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-04 | |
| d2cxka1 | 82 | b.1.18.1 (A:872-953) Calmodulin binding transcript | 4e-10 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-06 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-04 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-08 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 0.004 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-07 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 4e-06 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 3e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 5e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 6e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.003 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 9e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 3e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 5e-06 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.002 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.004 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-04 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 7e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.003 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 9e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 1e-04 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 0.003 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.0 bits (157), Expect = 1e-11
Identities = 24/128 (18%), Positives = 48/128 (37%), Gaps = 11/128 (8%)
Query: 479 KLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTAL 538
+ + L++ G G +H+ + G + ++ + K G++ L
Sbjct: 278 PVADVLIKH---GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPL 334
Query: 539 HWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 598
H AA G +V LL GA PN + G IA + G+ + L + +
Sbjct: 335 HQAAQQGHTDIVTLLLKNGASPNE------VSSDGTTPLAIAKRLGYISVTDVL--KVVT 386
Query: 599 AQFNDMTL 606
+ + + +
Sbjct: 387 DETSFVLV 394
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.81 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.81 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.8 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.76 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.75 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.74 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.73 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.73 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.71 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.7 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.69 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.69 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.68 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.67 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.67 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.67 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.67 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d2cxka1 | 82 | Calmodulin binding transcription activator 1 {Huma | 99.66 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.65 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.63 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.62 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.61 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.61 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.61 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.59 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.54 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.5 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.5 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.5 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.49 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.48 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.46 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.34 | |
| d1qhoa1 | 81 | Five domain "maltogenic" alpha-amylase (glucan 1,4 | 98.69 | |
| d1uadc_ | 92 | Exocyst complex component Sec5, Ral-binding domain | 98.59 | |
| d1p7hl1 | 103 | T-cell transcription factor NFAT1 (NFATC2) {Human | 98.54 | |
| d3bmva1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Th | 98.43 | |
| d3brda1 | 119 | DNA-binding protein LAG-1 (CSL) {Caenorhabditis el | 98.41 | |
| d1cxla1 | 87 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 98.4 | |
| d1cyga1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 98.36 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.17 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.16 | |
| d1imhc1 | 101 | T-cell transcription factor NFAT5 (TONEBP) {Human | 96.87 | |
| d1gjia1 | 100 | p65 subunit of NF-kappa B (NFKB), dimerization dom | 96.7 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 96.56 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 96.46 | |
| d1my7a_ | 107 | p65 subunit of NF-kappa B (NFKB), dimerization dom | 96.29 | |
| d1u36a_ | 104 | p50 subunit of NF-kappa B transcription factor {Hu | 95.96 | |
| d1a3qa1 | 101 | p52 subunit of NF-kappa B (NFKB) {Human (Homo sapi | 95.85 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.16 |
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Cell cycle inhibitor p16ink4A species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=2.5e-20 Score=173.59 Aligned_cols=120 Identities=20% Similarity=0.262 Sum_probs=109.3
Q ss_pred ccchHHHHHHcCCcHHHHHHHHHc-CCCCccccCCCCchHHHHHHcCCHHHHHHHHHCCCCCccccCCCC-cHHHHHHHc
Q 003097 467 AKDSFFELTLKSKLKEWLLERVVE-GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGW-TALHWAAYY 544 (848)
Q Consensus 467 ~~~~Ll~aa~~~~l~e~L~~~L~~-Ga~in~~D~~G~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~-TpLh~Aa~~ 544 (848)
..+.|+.|+..|++. +++.|++ |+++|..|..|.||||+|+ .|+.+++++|+++|+++|.+|..|. ||||+|+..
T Consensus 3 ~~~~L~~Aa~~G~~~--~v~~Ll~~gad~n~~~~~g~t~l~~a~-~g~~~~v~~Ll~~ga~~~~~~~~~~~~~L~~A~~~ 79 (125)
T d1bi7b_ 3 SADWLATAAARGRVE--EVRALLEAGANPNAPNSYGRRPIQVMM-MGSARVAELLLLHGAEPNCADPATLTRPVHDAARE 79 (125)
T ss_dssp STTHHHHHHHHTCHH--HHHHHHTTTCCTTCCCSSSCCTTTSSC-TTCHHHHHHHHTTTCCCCCCCTTTCCCHHHHHHHH
T ss_pred ChhHHHHHHHCCCHH--HHHHHHHcCCccccccccccccccccc-ccccccccccccccccccccccccccccccccccc
Confidence 457899999999876 5555555 9999999999999999764 7999999999999999999999876 699999999
Q ss_pred CCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHHHcCChHHHHHHHhh
Q 003097 545 GREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQ 595 (848)
Q Consensus 545 G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~~~G~~~iv~~Ll~~ 595 (848)
|+.+++++|+++|++++. +|..|.||||+|+.+|+.+++++|++.
T Consensus 80 g~~~~v~~Ll~~ga~~~~------~d~~G~T~l~~A~~~g~~~~v~~Llsa 124 (125)
T d1bi7b_ 80 GFLDTLVVLHRAGARLDV------RDAWGRLPVDLAEELGHRDVARYLRAA 124 (125)
T ss_dssp TCHHHHHHHHHHTCCSSC------CCTTCCCHHHHHHHHTCHHHHHHHSSC
T ss_pred cccccccccccccccccc------ccCCCCCHHHHHHHcCCHHHHHHHHhc
Confidence 999999999999999998 889999999999999999999999763
|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|