Citrus Sinensis ID: 003113

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840------
MKRELDYELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSENDSMCISYQNNKRERKKTRKLLEADLVSKSSSKSVSLRNLLKTRSPWELTRNSSRPGLIANSTPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKVR
cccccccccccccccccccccccccccccHHHHccccccccccEEEEEEcccEEEEEEcccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEcccccccccEEEEEEcccEEEccccccccEEccccccccccccccccccccEEEcccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEcccccEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccEEEccccHHHHccccccccccccccccccccEEEcccccccHHHHHHHccccccccccccHHHHHHccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEccEEEEEEEEEEEccEEEcccEEEEcccHHcccc
cccccccccccccccccccHccccccEEcccccccccccccEEEEEEEEcEEEEEEccccccccccHHHHHccccccccccccccccccccEEEccccccccccccccccccEEEcccccEEccccccccccccccccccccccccccccccccccccHHHHccccccccccHccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccEEEEEEcccccEEEEEEEEEcccEEEccccccccEEEcHHHHHHHccccccccccEEEEcccccHHHHHHHHHcccHHHHHHHHHHHcccccccccEEEEcccccccHHHcccccccccccccccccccccccccccEEEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccEEccccccccccccccccHHccccccccccHHHEEcccccccccEEEEEEcccEEcccEEEccccEcccccccccHHHcEEEcccccEEEcccccHHHHHHHcccccccccccccccccccccccccccccccHHHcccccccccccHcccccEEEEccccccccEEEEEcccccccccccccEEEEEccccHHHccHHccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHEEccccccccccEEEEEEEEEccEEEEEEEEEEEccEEEEccEEEEcHHcccccc
MKRELDYELagsldetstqslpqagiqasDCVKAACENVrckrfkvtkvnGFIVYSRvkrsrfsnsddlleddvidKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETvkgkkapickeepiskvecfprkeggsevsnglnkkclkrpsamkpkvepVEVLVTQsegfgnesMSLIEVEAIAegsaltspkknleLKMSkkislnkkpmtVTELFETGLLDGVSVVYMGGIKFQASglrgiirdggilcscslcngcrvippskfeiHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALsslpeeksfacvrckgtfpitcvgktgpgplcnscvkskkpqgtmtyttgirirasgpklvsrssendsmcisYQNNKRERKKTRKLLEADlvsksssksVSLRNLlktrspweltrnssrpglianstpvtsvhkssqsqRQRKITKKSKKTVLiskpfenaspplsfpnksrwnitpkdqrlhklvfdesglpdgtevgyYACGQKLLEGYKnglgiichccnsevspsqfeahadggnllpcdgcprafhkecaslssipqgdwyCKYCQNMFERKRFLQHDanaveagrvsgvdSVEQITKRCIRIVKNLEAELSGcllcrgcdfsksgfgprtillcdqcerefhvgclkkhkmadlrelpkgkwfccmdcsrINSVLQNLLVQEAEKLPEFHLNAIKKYAgnsletvsDIDVRWRllsgkaatpETRLLLSQAVAIFhdcfdpivdsisgrdlipsmvygrnlrgqefggMYCAILTVNSSVVSAGILRVFgqevaelplvatskinhgkvr
MKRELDYELAGSldetstqslpqAGIQASDCVKAACENVrckrfkvtkvngfivysrvkrsrfsnsddlleddvidkrinskihegrinkvvKNVLNENGILESVVEEENQLVQMTVENVIeetvkgkkapickeepiskvecfprkeggsevsnglnkkclkrpsamkpkvepVEVLVTQSEGFGNESMSLIEVEAIAegsaltspkknlelkmskkislnkkpmtVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFpitcvgktgpgplcnscvkskkpqgtmtyttgirirasgpklvsrssendsmcisyqnnkrerkkTRKLleadlvsksssksvslrnllktrspweltrnssrpglianstpvtsvhkssqsqrqrkitkkskktvliskpfenaspplsfpnksrwnitpkdqRLHKLVFdesglpdgtEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVeagrvsgvdsveqITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYagnsletvsDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFgqevaelplvatskinhgkvr
MKRELDYELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASglrgiirdggilCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSENDSMCISYQNNkrerkktrklleADlvsksssksvslRNLLKTRSPWELTRNSSRPGLIANSTPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKVR
*************************IQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPIC********************************************************************************************MTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVK*******MTYTTGIRI*********************************************************************************************************************************RLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVAT*********
**********************************************TKVNGFIVY***************************************************************************************************************************************************************************TVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEI******RRASQYICFENGKSLLEVLRA*************QSALSSLPEEKSFACVRCKGTF******KTGPGPLCNSCVKSK***************************************************************************************************************************************************LVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRF***************VDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHG***
*************************IQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRAS***********DSMCISYQNNKRERKKTRKLLEAD***********LRNLLKTRSPWELTRNSSRPGLIANS***********************KTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKVR
******************************C*KAACENVRCKRFKVTKVNGFIVYSRVKR**************************************NGILESVVEEENQLVQMTVENVIEET************************************************************************************************LNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSE*******************************************************************VHKSSQSQRQRKITKKSKKTVLISKPFENA*****FPNKS*****PKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRF*************SGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINH**V*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRELDYELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIVYSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQMTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLKRPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISLNKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSKFEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVRCKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTYTTGIRIRASGPKLVSRSSENDSMCISYQNNKRERKKTRKLLEADLVSKSSSKSVSLRNLLKTRSPWELTRNSSRPGLIANSTPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKLVFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVSDIDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGKVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query846 2.2.26 [Sep-21-2011]
Q14839 1912 Chromodomain-helicase-DNA yes no 0.166 0.073 0.266 5e-08
Q6PDQ2 1915 Chromodomain-helicase-DNA yes no 0.167 0.074 0.256 2e-07
O88491 2588 Histone-lysine N-methyltr no no 0.042 0.013 0.540 1e-05
Q96L73 2696 Histone-lysine N-methyltr no no 0.042 0.013 0.540 1e-05
Q22516 1787 Chromodomain-helicase-DNA yes no 0.118 0.055 0.246 2e-05
Q8TDI0 1954 Chromodomain-helicase-DNA no no 0.141 0.061 0.25 3e-05
O16102 892 Chromodomain-helicase-DNA no no 0.042 0.040 0.552 3e-05
Q6E2N31163 E3 ubiquitin-protein liga no no 0.044 0.032 0.5 5e-05
G5EBZ4 1829 Protein let-418 OS=Caenor no no 0.115 0.053 0.253 6e-05
Q12873 2000 Chromodomain-helicase-DNA no no 0.171 0.072 0.225 9e-05
>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 77/184 (41%), Gaps = 43/184 (23%)

Query: 538 LEGYKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKEC--ASLSSIPQGDW 595
           ++GY+      C  C              GG ++ CD CPRA+H  C    +   P+G W
Sbjct: 362 VDGYETDHQDYCEVCQQ------------GGEIILCDTCPRAYHMVCLDPDMEKAPEGKW 409

Query: 596 YCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGCL-LCRG 654
            C +C+     K  +Q +A    +    G + +E++         +LE E    +  CR 
Sbjct: 410 SCPHCE-----KEGIQWEAKEDNS---EGEEILEEVG-------GDLEEEDDHHMEFCRV 454

Query: 655 CDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFC--CMDCSRINSVLQ 712
           C   K G     +L CD C   +H+ CL       L E+P G+W C  C  C  +   +Q
Sbjct: 455 C---KDG---GELLCCDTCPSSYHIHCLN----PPLPEIPNGEWLCPRCT-CPALKGKVQ 503

Query: 713 NLLV 716
            +L+
Sbjct: 504 KILI 507
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 Back     alignment and function description
>sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 Back     alignment and function description
>sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 Back     alignment and function description
>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 Back     alignment and function description
>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 Back     alignment and function description
>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 Back     alignment and function description
>sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 Back     alignment and function description
>sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 Back     alignment and function description
>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query846
449524528937 PREDICTED: uncharacterized protein LOC10 0.926 0.836 0.496 0.0
449440157946 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.926 0.828 0.492 0.0
224140243741 predicted protein [Populus trichocarpa] 0.709 0.809 0.563 0.0
356570792796 PREDICTED: uncharacterized protein LOC10 0.765 0.814 0.494 0.0
224068881697 predicted protein [Populus trichocarpa] 0.679 0.824 0.524 0.0
357510879730 Chromodomain-helicase-DNA-binding protei 0.703 0.815 0.530 0.0
297827161 1007 hypothetical protein ARALYDRAFT_482652 [ 0.898 0.754 0.423 0.0
30686882 1007 acyl-CoA N-acyltransferase with RING/FYV 0.704 0.591 0.501 1e-179
359481940 2411 PREDICTED: uncharacterized protein LOC10 0.446 0.156 0.609 1e-155
297740008879 unnamed protein product [Vitis vinifera] 0.446 0.430 0.606 1e-151
>gi|449524528|ref|XP_004169274.1| PREDICTED: uncharacterized protein LOC101231774 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/916 (49%), Positives = 577/916 (62%), Gaps = 132/916 (14%)

Query: 1   MKRELDY------ELAGSLDETSTQSLPQAGIQASDCVKAACENVRCKRFKVTKVNGFIV 54
           MKREL +      +L G+LD T ++ L +A    S  +     +  CKRFK + VNG IV
Sbjct: 1   MKRELAFALEVQSQLEGTLDHTRSEILAEAR-PGSSYLDETARSGGCKRFKGSVVNGLIV 59

Query: 55  YSRVKRSRFSNSDDLLEDDVIDKRINSKIHEGRINKVVKNVLNENGILESVVEEENQLVQ 114
           Y+RV++S+ +    LL D+   K+ +S   +GR       VL      ES   EE Q+  
Sbjct: 60  YTRVRKSQINVYSGLL-DNGNRKKCDST--DGR------EVLGSFAPEESCRTEEVQI-- 108

Query: 115 MTVENVIEETVKGKKAPICKEEPISKVECFPRKEGGSEVSNGLNKKCLK----------- 163
                        K + +CK+E    VE    KE G+E S+ +  K +K           
Sbjct: 109 ------------QKTSSVCKKESDEVVENSGNKEEGAEGSSLVIAKDIKVEGNLPGWEIK 156

Query: 164 --RPSAMKPKVEPVEVLVTQSEGFGNESMSLIEVEAIAEGSALTSPKKNLELKMSKKISL 221
               S++ PKVEP+++          E +S +  E     ++L++PK  LELKMSKKI+L
Sbjct: 157 RFTRSSLGPKVEPMDITPLAIGSVKEEVISDVGGETSETVNSLSTPKNKLELKMSKKIAL 216

Query: 222 NKKPMTVTELFETGLLDGVSVVYMGGIKFQASGLRGIIRDGGILCSCSLCNGCRVIPPSK 281
           NK+PMTV ELFETGLL+GV V+YMG  K    GLRG I+D GILC+CS CNGCRVIPPS+
Sbjct: 217 NKRPMTVRELFETGLLEGVPVIYMGVKKADDFGLRGTIKDSGILCTCSSCNGCRVIPPSQ 276

Query: 282 FEIHACKQYRRASQYICFENGKSLLEVLRACRSVPLPMLKATLQSALSSLPEEKSFACVR 341
           FEIHAC QY+RA+QYIC ENGKSLL++L+AC+      L+AT+QS +SS PEEK F C  
Sbjct: 277 FEIHACNQYKRAAQYICLENGKSLLDLLKACKG-SRQTLEATVQSLISSSPEEKHFTCRD 335

Query: 342 CKGTFPITCVGKTGPGPLCNSCVKSKKPQGTMTY----TTGI--RIRASGPKLVSRSSEN 395
           CKG FP + VG+ GP  LC SC +SK+ +  +T     T+GI  R+R + P     ++  
Sbjct: 336 CKGCFP-SSVGQVGP--LCPSCEESKRSKWMLTLPAPPTSGIGKRLRLAEP-----TTSK 387

Query: 396 DSMCISYQNNKRERKKTRKLLEADLVSKSSSKSVSLRNLLKTRSPWELTRNSSRPGLIAN 455
            S   S   + R ++K         V+K+ SKS    ++  +RSP               
Sbjct: 388 SSGSASVSISSRYKRK--------WVTKAKSKSSEYTSI--SRSP--------------R 423

Query: 456 STPVTSVHKSSQSQRQRKITKKSKKTVLISKPFENASPPLSFPNKSRWNITPKDQRLHKL 515
           S P+    K+  + + RK   KS K  L+ K  ++AS   S   K++W IT KDQRLHKL
Sbjct: 424 SAPMRIPSKNKSALKMRK---KSLKPALMLKSSQSASKCSSSLAKNQWKITTKDQRLHKL 480

Query: 516 VFDESGLPDGTEVGYYACGQKLLEGYKNGLGIICHCCNSEVSPSQFEAHA---------- 565
           VF+E GLPDGTEV Y+A GQKLL+GYK G GI+C CCN  VSPSQFE HA          
Sbjct: 481 VFEEDGLPDGTEVAYFARGQKLLQGYKKGSGILCCCCNCVVSPSQFEVHAGWSSRKKPYA 540

Query: 566 ------------------------------------DGGNLLPCDGCPRAFHKECASLSS 589
                                               DGGNLL CDGCPRAFHKECASLSS
Sbjct: 541 YIYTSNGVSLHELAISLSKGRKYSAKDNDDLCIICLDGGNLLLCDGCPRAFHKECASLSS 600

Query: 590 IPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSGVDSVEQITKRCIRIVKNLEAELSGC 649
            P+GDWYCK+CQNMF+R++F++H+ NAV AGRV GVD +EQITKRCIRIV+N+E +LSGC
Sbjct: 601 TPRGDWYCKFCQNMFQREKFVEHNVNAVAAGRVHGVDPIEQITKRCIRIVRNIETDLSGC 660

Query: 650 LLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGKWFCCMDCSRINS 709
           +LCRG DFSKSGFGPRTI+LCDQCE+EFHVGCLK HKMA L+ELP+GKWFC + C+RI+S
Sbjct: 661 VLCRGSDFSKSGFGPRTIILCDQCEKEFHVGCLKDHKMAFLKELPRGKWFCSIVCTRIHS 720

Query: 710 VLQNLLVQEAEKLPEFHLNAIKKYAGNSLETVS-DIDVRWRLLSGKAATPETRLLLSQAV 768
            LQ LL++  EKLP   L A+ +  G +   +  D+DV WRL+SGK A+PETRLLLS+A+
Sbjct: 721 ALQKLLIRGPEKLPNSLLGAVNRKLGENCSDIQVDVDVSWRLISGKIASPETRLLLSEAI 780

Query: 769 AIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFGGMYCAILTVNSSVVSAGILRVFGQE 828
           AIFHD FDPIVD  SGRDLIP+MVYGR++ GQEFGGMYCAIL VNS VVSA +LRVFGQ+
Sbjct: 781 AIFHDRFDPIVDITSGRDLIPAMVYGRDVGGQEFGGMYCAILIVNSFVVSAAMLRVFGQD 840

Query: 829 VAELPLVATSKINHGK 844
           +AELPLVATS  NHGK
Sbjct: 841 IAELPLVATSNGNHGK 856

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449440157|ref|XP_004137851.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101203549 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224140243|ref|XP_002323493.1| predicted protein [Populus trichocarpa] gi|222868123|gb|EEF05254.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356570792|ref|XP_003553568.1| PREDICTED: uncharacterized protein LOC100802562 [Glycine max] Back     alignment and taxonomy information
>gi|224068881|ref|XP_002326222.1| predicted protein [Populus trichocarpa] gi|222833415|gb|EEE71892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357510879|ref|XP_003625728.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula] gi|355500743|gb|AES81946.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297827161|ref|XP_002881463.1| hypothetical protein ARALYDRAFT_482652 [Arabidopsis lyrata subsp. lyrata] gi|297327302|gb|EFH57722.1| hypothetical protein ARALYDRAFT_482652 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30686882|ref|NP_850270.1| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] gi|20260434|gb|AAM13115.1| putative PHD-type zinc finger protein [Arabidopsis thaliana] gi|31711790|gb|AAP68251.1| At2g36720 [Arabidopsis thaliana] gi|330254196|gb|AEC09290.1| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359481940|ref|XP_002264975.2| PREDICTED: uncharacterized protein LOC100248757 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740008|emb|CBI30190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query846
TAIR|locus:2040550 1007 AT2G36720 "AT2G36720" [Arabido 0.330 0.278 0.608 1.5e-167
TAIR|locus:2147391 1179 AT5G36740 [Arabidopsis thalian 0.094 0.067 0.290 1.4e-20
TAIR|locus:2832118 1193 AT5G36670 [Arabidopsis thalian 0.094 0.067 0.290 1.5e-20
TAIR|locus:2163961557 AT5G63900 "AT5G63900" [Arabido 0.140 0.213 0.298 2.1e-15
TAIR|locus:2178828 1065 AT5G58610 "AT5G58610" [Arabido 0.101 0.080 0.314 3.3e-15
TAIR|locus:2201021 1138 AT1G05380 "AT1G05380" [Arabido 0.442 0.328 0.264 6.3e-15
TAIR|locus:2168088425 AT5G59830 "AT5G59830" [Arabido 0.198 0.395 0.271 1.5e-11
TAIR|locus:2086395 1189 ROS4 "AT3G14980" [Arabidopsis 0.327 0.232 0.258 4.6e-10
UNIPROTKB|F5GWX5 1905 CHD4 "Chromodomain-helicase-DN 0.047 0.020 0.380 4.7e-07
UNIPROTKB|E2RHA0 1912 CHD4 "Uncharacterized protein" 0.047 0.020 0.380 4.8e-07
TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 974 (347.9 bits), Expect = 1.5e-167, Sum P(3) = 1.5e-167
 Identities = 171/281 (60%), Positives = 224/281 (79%)

Query:   565 ADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVSG 624
             ADGGNLL CD CPRAFH EC SL SIP+G+W+CKYC+N F  +   +++ N+   G++ G
Sbjct:   622 ADGGNLLLCDSCPRAFHIECVSLPSIPRGNWHCKYCENKFTSEIAGEYNVNSSAVGQLEG 681

Query:   625 VDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKK 684
             VD V+Q+  RCIR+VKN+EAE +GC+LC G DF +SGFGPRTI++CDQCE+E+H+GCL  
Sbjct:   682 VDPVDQLAGRCIRVVKNMEAETNGCVLCSGSDFCRSGFGPRTIIICDQCEKEYHIGCLSS 741

Query:   685 HKMADLRELPKGKWFCCMDCSRINSVLQNLLVQEAEKLPEFHLNAIK-KYAGNSLETVSD 743
               + DL+ELPKG WFC MDC+RINS LQ LL+  AEKL +  L  I+ K   N + ++SD
Sbjct:   742 QNIVDLKELPKGNWFCSMDCTRINSTLQKLLLGGAEKLSDSSLGIIQTKQERNDVYSISD 801

Query:   744 IDVRWRLLSGKAATPETRLLLSQAVAIFHDCFDPIVDSISGRDLIPSMVYGRNLRGQEFG 803
             +D+RWRL+SGK  +PE+R+LLSQA+AIFHDCFDPIVD +SG +LIP MVYG+ ++GQ++G
Sbjct:   802 LDIRWRLISGKVTSPESRMLLSQALAIFHDCFDPIVDPLSGSNLIPRMVYGKTMQGQDYG 861

Query:   804 GMYCAILTVNSSVVSAGILRVFGQEVAELPLVATSKINHGK 844
             G+ CA+LTVN++VVSAG+LRVFG+EVAELPLVAT   +  K
Sbjct:   862 GICCAVLTVNATVVSAGLLRVFGREVAELPLVATRMCSREK 902
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009630 "gravitropism" evidence=RCA
TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163961 AT5G63900 "AT5G63900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178828 AT5G58610 "AT5G58610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168088 AT5G59830 "AT5G59830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWX5 CHD4 "Chromodomain-helicase-DNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHA0 CHD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVI.3095.1
hypothetical protein (732 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query846
pfam0062851 pfam00628, PHD, PHD-finger 1e-06
smart0024947 smart00249, PHD, PHD zinc finger 4e-05
pfam0062851 pfam00628, PHD, PHD-finger 2e-04
smart0024947 smart00249, PHD, PHD zinc finger 3e-04
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 0.002
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 0.004
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 45.9 bits (109), Expect = 1e-06
 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 13/59 (22%)

Query: 548 ICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLS----SIPQGDWYCKYCQN 602
            C  C             D G LL CDGC R FH  C         IP+G+WYC  C+ 
Sbjct: 1   YCAVCGKV---------DDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 846
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 99.07
KOG0956 900 consensus PHD finger protein AF10 [General functio 99.01
KOG1244336 consensus Predicted transcription factor Requiem/N 98.98
KOG1512381 consensus PHD Zn-finger protein [General function 98.71
COG5141 669 PHD zinc finger-containing protein [General functi 98.56
KOG4299613 consensus PHD Zn-finger protein [General function 98.54
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 98.53
KOG0954 893 consensus PHD finger protein [General function pre 98.51
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.48
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.45
KOG0383 696 consensus Predicted helicase [General function pre 98.41
KOG4299 613 consensus PHD Zn-finger protein [General function 98.28
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.11
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.04
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.92
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.88
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.83
KOG1973274 consensus Chromatin remodeling protein, contains P 97.81
KOG1512381 consensus PHD Zn-finger protein [General function 97.75
KOG1244336 consensus Predicted transcription factor Requiem/N 97.74
KOG0383 696 consensus Predicted helicase [General function pre 97.71
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.65
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.34
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.29
KOG1973274 consensus Chromatin remodeling protein, contains P 97.16
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.12
KOG0957 707 consensus PHD finger protein [General function pre 97.08
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.01
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.86
KOG0957707 consensus PHD finger protein [General function pre 96.65
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.34
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 95.94
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.89
KOG0956 900 consensus PHD finger protein AF10 [General functio 95.12
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 95.11
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 95.08
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 95.08
COG5141 669 PHD zinc finger-containing protein [General functi 93.51
smart0025873 SAND SAND domain. 92.45
KOG0954 893 consensus PHD finger protein [General function pre 91.98
PF0134282 SAND: SAND domain; InterPro: IPR000770 The SAND do 90.91
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 89.45
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 87.52
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 84.54
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 84.38
PF07897284 DUF1675: Protein of unknown function (DUF1675); In 84.28
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 84.17
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 81.81
KOG2752345 consensus Uncharacterized conserved protein, conta 80.29
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.07  E-value=1e-10  Score=132.13  Aligned_cols=207  Identities=19%  Similarity=0.260  Sum_probs=139.3

Q ss_pred             CCCcccccCCCCCCCCcccccCCCCceeccCCCCcccccccCCCCCCCCCCccccccccccccccccccccccccccccc
Q 003113          544 GLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECASLSSIPQGDWYCKYCQNMFERKRFLQHDANAVEAGRVS  623 (846)
Q Consensus       544 ~~gi~C~~C~~~vSpS~FE~HAdgG~Ll~CD~Cp~afH~~CL~L~~vP~g~W~Cp~C~~~~~~ek~va~n~na~a~Gr~~  623 (846)
                      .....|.+|..+...       .+.++..|+.|.++||+.|.-......+.|.+..|...+--....+.     ..|+..
T Consensus        81 ~~e~~~nv~~s~~~~-------p~~e~~~~~r~~~~~~q~~~i~~~~~~~~~~~~~c~~~~~~~~g~a~-----K~g~~a  148 (464)
T KOG4323|consen   81 SSELNPNVLTSETVL-------PENEKVICGRCKSGYHQGCNIPRFPSLDIGESTECVFPIFSQEGGAL-----KKGRLA  148 (464)
T ss_pred             ccccCCccccccccc-------CchhhhhhhhhccCcccccCccCcCcCCccccccccccccccccccc-----cccccc
Confidence            455678888864433       46789999999999999998543344467999988765321111111     112211


Q ss_pred             ------CcCchhhhhhhhhhhhccccccCCCcccccCCCCCCCCCCCCceeeCCCCCCcCCCCCCCCCCCccccCCCCCC
Q 003113          624 ------GVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGK  697 (846)
Q Consensus       624 ------Gvd~ieqi~~rc~R~~kd~e~e~~~C~iCg~~dfs~sg~~~~tLL~CDqCer~YHv~CL~p~~~~~LkevP~g~  697 (846)
                            +...+++...+.        .+ ..|.+|....+   + ..+.||+|+.|..|||..|.++..-..+-..|.++
T Consensus       149 ~~~l~y~~~~l~wD~~~~--------~n-~qc~vC~~g~~---~-~~NrmlqC~~C~~~fHq~Chqp~i~~~l~~D~~~~  215 (464)
T KOG4323|consen  149 RPSLPYPEASLDWDSGHK--------VN-LQCSVCYCGGP---G-AGNRMLQCDKCRQWYHQACHQPLIKDELAGDPFYE  215 (464)
T ss_pred             cccccCcccccccCcccc--------cc-ceeeeeecCCc---C-ccceeeeecccccHHHHHhccCCCCHhhccCccce
Confidence                  222222111111        11 12888875432   2 23489999999999999999997666666778999


Q ss_pred             cEEcCCccchhHHHHhhhhccccccchhhHH--Hhh--hhhcCcccccccccceeEEcc-CCCCC---hHHHHHHHHHHH
Q 003113          698 WFCCMDCSRINSVLQNLLVQEAEKLPEFHLN--AIK--KYAGNSLETVSDIDVRWRLLS-GKAAT---PETRLLLSQAVA  769 (846)
Q Consensus       698 WfC~~~C~~I~s~LqkLva~g~e~lp~sll~--~Ik--k~~e~gle~~~~~dikW~LLs-gk~as---~E~~skLa~AL~  769 (846)
                      ||| ..|.+-...+.++-++|++.++..+.+  .+.  +|+..-+++....+-.|..|. |...+   .+..+.+..|++
T Consensus       216 w~C-~~C~~~~~~~~r~t~~~~dv~~lal~~~~~~~~~k~~~~~~ei~~f~e~~~~slp~~e~~tsp~~~~~~~~lsal~  294 (464)
T KOG4323|consen  216 WFC-DVCNRGPKKVPRLTLRWADVLHLALYNLKPMLKKKYFKSLVEILLFCEESWPSLPFYEPKTSPVTERSSSLLSALS  294 (464)
T ss_pred             Eee-hhhccchhhccccccccccccchhhhhhhhhhccCCcccHHHHHHHHhhccccccccCCccccccchhhHHHHhhh
Confidence            999 899999999999999999998877744  333  667666666666777888775 44443   456778888888


Q ss_pred             HhhhhcC
Q 003113          770 IFHDCFD  776 (846)
Q Consensus       770 Im~EcF~  776 (846)
                      -....|.
T Consensus       295 ~~~~~f~  301 (464)
T KOG4323|consen  295 SYKSRFV  301 (464)
T ss_pred             ccccccc
Confidence            8776664

>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>smart00258 SAND SAND domain Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF07897 DUF1675: Protein of unknown function (DUF1675); InterPro: IPR012463 The members of this family are sequences derived from hypothetical plant proteins of unknown function Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query846
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 2e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 2e-05
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 2e-05
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 3e-05
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
Query: 566 DGGNLLPCDGCPRAFHKECAS--LSSIPQGDWYCKYC 600
           DGG L+ CDGCPRAFH  C S  L  IP G W C  C
Sbjct: 16  DGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSC 52
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query846
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 5e-13
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 7e-05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 7e-13
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-05
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-12
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 2e-05
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-12
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-06
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 2e-12
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 9e-06
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 7e-12
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 6e-04
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-11
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 3e-11
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-10
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 8e-10
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 8e-04
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-08
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-08
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 3e-04
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-08
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 5e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-08
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-08
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-08
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 7e-08
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 1e-07
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 3e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-07
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 2e-07
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-07
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 7e-05
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 3e-07
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 1e-04
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-07
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-04
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 5e-07
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 7e-05
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 1e-06
2yt5_A66 Metal-response element-binding transcription facto 1e-06
2yt5_A66 Metal-response element-binding transcription facto 8e-05
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 9e-06
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 3e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 4e-05
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 6e-05
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 1e-04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 2e-04
1weu_A91 Inhibitor of growth family, member 4; structural g 2e-04
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 7e-04
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 8e-04
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
 Score = 63.6 bits (155), Expect = 5e-13
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 566 DGGNLLPCDGCPRAFHKECAS--LSSIPQGDWYCKYCQNMFERKR 608
           DGG L+ CDGCPRAFH  C S  L  IP G W C  C     ++ 
Sbjct: 16  DGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEV 60
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query846
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.7
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.68
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.64
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.56
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.0
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.96
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.93
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.93
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.91
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.89
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.88
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.88
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.85
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.84
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.79
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.79
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.74
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.73
2yt5_A66 Metal-response element-binding transcription facto 98.73
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.71
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.7
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.69
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.68
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.66
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.63
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.62
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.61
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.6
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.59
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.59
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.57
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.57
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.56
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.55
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.54
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.53
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.48
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.46
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.45
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.45
1weu_A91 Inhibitor of growth family, member 4; structural g 98.41
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.4
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.38
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.36
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.35
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.35
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.35
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.34
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.32
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.32
2yt5_A66 Metal-response element-binding transcription facto 98.28
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.25
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.23
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.18
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.16
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.1
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.09
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.07
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.07
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.02
1weu_A91 Inhibitor of growth family, member 4; structural g 97.98
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 97.93
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.91
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.88
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.88
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.88
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.86
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.76
1we9_A64 PHD finger family protein; structural genomics, PH 97.59
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.54
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.48
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.45
1we9_A64 PHD finger family protein; structural genomics, PH 97.44
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.4
1wee_A72 PHD finger family protein; structural genomics, PH 97.33
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.32
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 97.27
1wee_A72 PHD finger family protein; structural genomics, PH 97.23
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.2
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.18
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.08
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.06
1wew_A78 DNA-binding family protein; structural genomics, P 97.04
1wem_A76 Death associated transcription factor 1; structura 97.03
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.0
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.0
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.0
1wem_A76 Death associated transcription factor 1; structura 96.99
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 96.95
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.93
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 96.91
1wew_A78 DNA-binding family protein; structural genomics, P 96.91
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 96.89
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.86
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 96.81
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.79
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.79
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.72
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.44
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.26
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.23
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.09
3kv5_D 488 JMJC domain-containing histone demethylation prote 95.23
3kv5_D 488 JMJC domain-containing histone demethylation prote 95.19
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.31
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.14
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 93.66
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 92.44
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 91.59
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 90.36
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 88.02
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 86.26
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 86.06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 85.57
3efa_A147 Putative acetyltransferase; structural genom 2, pr 85.14
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 84.49
2ect_A78 Ring finger protein 126; metal binding protein, st 83.79
2ecm_A55 Ring finger and CHY zinc finger domain- containing 83.62
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 82.98
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 82.57
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 81.89
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 80.44
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 80.06
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.70  E-value=7e-18  Score=156.15  Aligned_cols=94  Identities=27%  Similarity=0.846  Sum_probs=78.6

Q ss_pred             cCCCcccccCCCCCCCCcccccCCCCc---eeccCCCCcccccccCCCC--CCCCCCccccccccccccccccccccccc
Q 003113          543 NGLGIICHCCNSEVSPSQFEAHADGGN---LLPCDGCPRAFHKECASLS--SIPQGDWYCKYCQNMFERKRFLQHDANAV  617 (846)
Q Consensus       543 ~~~gi~C~~C~~~vSpS~FE~HAdgG~---Ll~CD~Cp~afH~~CL~L~--~vP~g~W~Cp~C~~~~~~ek~va~n~na~  617 (846)
                      ..+.+.|.+|..            +|+   ||+|++|+++||+.||++.  .++++.|+|+.|.                
T Consensus         4 ~~~~~~C~~C~~------------~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~----------------   55 (111)
T 2ysm_A            4 GSSGANCAVCDS------------PGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECK----------------   55 (111)
T ss_dssp             CCCCSCBTTTCC------------CCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTC----------------
T ss_pred             CCCCCCCcCCCC------------CCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCC----------------
Confidence            457889999994            454   4999999999999999854  4567999999996                


Q ss_pred             ccccccCcCchhhhhhhhhhhhccccccCCCcccccCCCCCCCCCCCCceeeCCCCCCcCCCCCCCCCCCccccCCCCCC
Q 003113          618 EAGRVSGVDSVEQITKRCIRIVKNLEAELSGCLLCRGCDFSKSGFGPRTILLCDQCEREFHVGCLKKHKMADLRELPKGK  697 (846)
Q Consensus       618 a~Gr~~Gvd~ieqi~~rc~R~~kd~e~e~~~C~iCg~~dfs~sg~~~~tLL~CDqCer~YHv~CL~p~~~~~LkevP~g~  697 (846)
                                                    .|.+|+..+      ++..+|.||+|+++||+.||+|    +|.++|++.
T Consensus        56 ------------------------------~C~~C~~~~------~~~~ll~Cd~C~~~yH~~Cl~p----pl~~~P~g~   95 (111)
T 2ysm_A           56 ------------------------------VCQNCKQSG------EDSKMLVCDTCDKGYHTFCLQP----VMKSVPTNG   95 (111)
T ss_dssp             ------------------------------CCTTTCCCS------CCTTEEECSSSCCEEEGGGSSS----CCSSCCSSC
T ss_pred             ------------------------------cccccCccC------CCCCeeECCCCCcHHhHHhcCC----ccccCCCCC
Confidence                                          388898653      4567999999999999999998    688899999


Q ss_pred             cEEcCCcc
Q 003113          698 WFCCMDCS  705 (846)
Q Consensus       698 WfC~~~C~  705 (846)
                      ||| +.|.
T Consensus        96 W~C-~~C~  102 (111)
T 2ysm_A           96 WKC-KNCR  102 (111)
T ss_dssp             CCC-HHHH
T ss_pred             cCC-cCCc
Confidence            999 5664
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 846
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 3e-09
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 3e-06
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-08
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-05
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 4e-08
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 7e-08
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-06
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-06
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 5e-07
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 4e-06
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 0.003
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 7e-06
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-04
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-04
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 2e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 0.002
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.9 bits (124), Expect = 3e-09
 Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 14/63 (22%)

Query: 547 IICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECA--SLSSIPQGDWYCKYCQNMF 604
            IC  C               G+L+ C+ C   FH +C   +L  +P  +W C  C  + 
Sbjct: 8   TICRVCQ------------KPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLP 55

Query: 605 ERK 607
           + K
Sbjct: 56  DLK 58
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query846
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.77
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.72
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.64
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.52
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.47
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.43
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.31
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.17
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.15
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.1
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.78
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.67
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.59
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.58
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.57
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.56
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 97.55
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.51
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.47
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 97.35
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.25
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.06
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 96.87
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.77
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.36
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 94.57
d1ufna_94 Putative nuclear protein homolog 5830484a20rik {Mo 93.28
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.83
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 91.04
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 88.44
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 84.49
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 81.94
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 80.3
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 80.04
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.77  E-value=1.9e-09  Score=90.46  Aligned_cols=50  Identities=30%  Similarity=0.862  Sum_probs=43.9

Q ss_pred             cccCCCcccccCCCCCCCCcccccCCCCceeccCCCCcccccccCC--CCCCCCCCcccccccc
Q 003113          541 YKNGLGIICHCCNSEVSPSQFEAHADGGNLLPCDGCPRAFHKECAS--LSSIPQGDWYCKYCQN  602 (846)
Q Consensus       541 ~~~~~gi~C~~C~~~vSpS~FE~HAdgG~Ll~CD~Cp~afH~~CL~--L~~vP~g~W~Cp~C~~  602 (846)
                      .......+|.+|+            ++|+||+||+|+++||..|++  +..+|.++|+|+.|..
T Consensus         2 ~~Dd~c~~C~~C~------------~~~~ll~Cd~C~~~~H~~C~~p~l~~~p~~~W~C~~C~~   53 (70)
T d1fp0a1           2 TLDDSATICRVCQ------------KPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHV   53 (70)
T ss_dssp             SSSSSSSCCSSSC------------SSSCCEECTTSSCEECTTSSSTTCCCCCSSSCCCCSCCC
T ss_pred             CcCCCCCCCCCCC------------CcCEEEECCCCChhhccccCCCCcCcCCCCCEECcCCcC
Confidence            3455677899998            578999999999999999998  7889999999999974
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure