Citrus Sinensis ID: 003116


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840------
MHCIIFLAFIVFTRHLCCFFIFCSGVVIAEGILGNDKIFQNHGNSWGYLILLYIFVQVSRLFVVGTLYPVLRNFGYGLEWKEAIILVWSGLRGAVALSLSLSVKRSSGGSSLITSETGTLFVFFTGGIVFLTLIVNGSTTQYILHLLDMDKLSATKRRILDYTKYEMLNTAFKTFGDLGDDEELGPVDWPTVKRYIRCLNDLEGVPMHPHSASETGDSLDPTNLRDIRIRLLNGVQAAYWAMLDEGRITQTAANILMQSVDEGIDLASNELCDWRGLKDNVSFPNYYKFLQTSMFPQKLITYFTVERLEFACSICAAFLRAHKIARQQLHDFIGDSGIASVVIEESKVEGEDARKFLEDVRVNFPQVLHVVKTRQVTYSVLNHLIDYIQNLEKVGLLEEKEMLHLHDAVQSDLKRLLRNPPLVKFPKISDLISAHPLLRELPPSVREPLELSTKEIMKLSGVTLYREGSKPSGIWLISNGVVKWTSKSIRNKHSLHPVFTHGSNLGLYEVLIGKPYMSDMVTDSVVLCFFIESDKILSILRSDPAVEDFLWQQSAIALSRILLPQIFEKLTMQDMRALIAERSKMTTCLRGEIIEIPYHCIGFLLEGFIKTHGLQEELITPPAALIPSQGNLSFRSAETSGVEAVSFSHQGSCYLVETRARVIIFDIAAFEADKAVVRRTSSLFSHSSDQPHKSLSREHGNLMSWPEHFYKARQQKQNSEETDRKANSLSARAMQLSIFGNMVDVQRRSRSFATGTQTMQSHSLSFPSIPSHLNRRLVSVRSEGATTVREKLEVSRSTGQIPAPPSQNAGANESHVIDYSSDDSGAEDELIVRIDSPSLLSFPQDS
ccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHccccccccccccHHHHHHHcccEEEcccccEEEEccccccEEEEEEEEEEEEEECccccccccccccccccHHHHHHHccccccEEEEEEEEEEEEEEEcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEcccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccEEEEcccccEEcccEEEEEEcccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccc
MHCIIFLAFIVFTRHLCCFFIFCSGVVIAEGILGNDKIFQNHGNSWGYLILLYIFVQVSRLFVVGTLYPVLRNFGYGLEWKEAIILVWSGLRGAVALSLSLSVKRSSGGSSLITSETGTLFVFFTGGIVFLTLIVNGSTTQYILHLLDMDKLSATKRRILDYTKYEMLNTAFKTFGDLGDDEELGPVDWPTVKRYIRCLNDLEGV*****************NLRDIRIRLLNGVQAAYWAMLDEGRITQTAANILMQSVDEGIDLASNELCDWRGLKDNVSFPNYYKFLQTSMFPQKLITYFTVERLEFACSICAAFLRAHKIARQQLHDFIGDSGIASVVIEESKVEGEDARKFLEDVRVNFPQVLHVVKTRQVTYSVLNHLIDYIQNLEKVGLLEEKEMLHLHDAVQSDLKRLLRNPPLVKFPKISDLISAHPLLRELPPSVREPLELSTKEIMKLSGVTLYREGSKPSGIWLISNGVVKWTSKSIRNKHSLHPVFTHGSNLGLYEVLIGKPYMSDMVTDSVVLCFFIESDKILSILRSDPAVEDFLWQQSAIALSRILLPQIFEKLTMQDMRALIAERSKMTTCLRGEIIEIPYHCIGFLLEGFIKTHGLQEELITPPAALIPSQG*L********GVEAVSFSHQGSCYLVETRARVIIFDIAAFEAD**************************************************************LSIFG*******************************************************************************************VRIDSPS**S*****
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHCIIFLAFIVFTRHLCCFFIFCSGVVIAEGILGNDKIFQNHGNSWGYLILLYIFVQVSRLFVVGTLYPVLRNFGYGLEWKEAIILVWSGLRGAVALSLSLSVKRSSGGSSLITSETGTLFVFFTGGIVFLTLIVNGSTTQYILHLLDMDKLSATKRRILDYTKYEMLNTAFKTFGDLGDDEELGPVDWPTVKRYIRCLNDLEGVPMHPHSASETGDSLDPTNLRDIRIRLLNGVQAAYWAMLDEGRITQTAANILMQSVDEGIDLASNELCDWRGLKDNVSFPNYYKFLQTSMFPQKLITYFTVERLEFACSICAAFLRAHKIARQQLHDFIGDSGIASVVIEESKVEGEDARKFLEDVRVNFPQVLHVVKTRQVTYSVLNHLIDYIQNLEKVGLLEEKEMLHLHDAVQSDLKRLLRNPPLVKFPKISDLISAHPLLRELPPSVREPLELSTKEIMKLSGVTLYREGSKPSGIWLISNGVVKWTSKSIRNKHSLHPVFTHGSNLGLYEVLIGKPYMSDMVTDSVVLCFFIESDKILSILRSDPAVEDFLWQQSAIALSRILLPQIFEKLTMQDMRALIAERSKMTTCLRGEIIEIPYHCIGFLLEGFIKTHGLQEELITPPAALIPSQGNLSFRSAETSGVEAVSFSHQGSCYLVETRARVIIFDIAAFEADKAVVRRTSSLFSHSSDQPHKSLSREHGNLMSWPEHFYKARQQKQNSEETDRKANSLSARAMQLSIFGNMVDVQRRSRSFATGTQTMQSHSLSFPSIPSHLNRRLVSVRSEGATTVREKLEVSRSTGQIPAPPSQNAGANESHVIDYSSDDSGAEDELIVRIDSPSLLSFPQDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 7 Acts in electroneutral exchange of protons for cations such as Na(+) or Li(+) across plasma membrane. Involved in Na(+) and K(+) homeostasis. Required for cytoplasmic Na(+) and Li(+) detoxification by secreting them from the cytoplasm to the extracellular space. Regulates Na(+) content of the xylem sap.probableQ9LKW9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QCS, chain B
Confidence level:very confident
Coverage over the Query: 428-671
View the alignment between query and template
View the model in PyMOL
Template: 1ZYB, chain A
Confidence level:confident
Coverage over the Query: 420-647,660-671
View the alignment between query and template
View the model in PyMOL
Template: 3BPZ, chain A
Confidence level:confident
Coverage over the Query: 363-417,428-560
View the alignment between query and template
View the model in PyMOL
Template: 2KBV, chain A
Confidence level:probable
Coverage over the Query: 81-105
View the alignment between query and template
View the model in PyMOL