Citrus Sinensis ID: 003304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830--
MAKAEAGQSPPLPPSPPLMPPNVKPEHVDLPRHSIMSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLYQTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGKRSKHSFQSKTFMVEISFATKIPLRSIALALKGNEVDNTQDALRVLDIVLRQQAANWGCLLVRQSFFHDDSRNLVDVGGGVSGIRGFHSSFRPTQGGLSLNMDVSTTMILKPGPVIDFLIANQNVREPRFIDWTKAKKMLRNLRVKPRHRNMEFKIVGLSEKPCNQQFFPMKVKSTEGTNEGETLEITVYDYFTQHCRIELTYSAYLPCLDVGKPKRPNYLPLELCSLVSLQRYTKALSSMQRASLVEKSRQKPQDRMRTLTDALRSYSYDEDPVLAACGISIGKQLTQVDGRILEIPKLKVGKSEDCIPRNGRWNFNNKRFLEATRIDRWIVVNFSARCDTSHISRELINCGRNKGIHIERPFTLIEEDQQTRRGNPVVRVERMFELITEKLPGPPQFILCVLPERKNSDIYGPWKKKSLSDFGIATQCISPTKINDQYLTNVLLKINSKLGGINSLLALEQSSLIPLIKDTPTMILGMDVSHGSPGRSDIPSVAAVVGSQSWPLISRYRAAVRTQSSKVEMIDALYKPIANGNDDGIIRELLLDFYRTSKQRKPKQIIIFRDGVSESQFNQVLNIELEQIIKAYQHLGEADIPKFTVIVAQKNHHTKLFQASGPENVPPGTVVDTRIVHPRNYDFYMCAHAGMIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYV
ccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccCEECcccCEECccccccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEECcCEEEECccccCEEEEEEccEEEECccccHHHHHHHHcccccccHHHHHHHHHHccccEEEEcccccEEEEcccccccccccccccccccccccccccccEEEHHHHHHHHcccEEECcccccCECcccccccccccccEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHcccEEccccccccEEECccccEEccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccccCEECccccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHccccccEEEECccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEECcccccccccccccEEEEEEECccccccEEEEEEEEcccccHHHcccccccccccccHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccCEEcccccccccccEEEECcccccccccccCEEEEEccccccHHHHHHHHHHcccc
**************************************RGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLYQTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEE**************************FQSKTFMVEISFATKIPLRSIALALKGNEVDNTQDALRVLDIVLRQQAANWGCLLVRQSFFHDDSRNLVDVGGGVSGIRGFHSSFRPTQGGLSLNMDVSTTMILKPGPVIDFLIANQNVREPRFIDWTKAKKMLRNLRVKPRHRNMEFKIVGLSEKPCNQQFFPMKVKSTEGTNEGETLEITVYDYFTQHCRIELTYSAYLPCLDVGKPKRPNYLPLELCSLVSLQRYTKALSSMQRASLVEKSRQKPQDRMRTLTDALRSYSYDEDPVLAACGISIGKQLTQVDGRILEIPKLKVGKSEDCIPRNGRWNFNNKRFLEATRIDRWIVVNFSARCDTSHISRELINCGRNKGIHIERPFTLIEEDQQTRRGNPVVRVERMFELITEKLPGPPQFILCVLPERKNSDIYGPWKKKSLSDFGIATQCISPTKINDQYLTNVLLKINSKLGGINSLLALEQSSLIPLIKDTPTMILGMDVSHGS******PSVAAVVGSQSWPLISRYRAAVRTQSSKVEMIDALYKPIANGNDDGIIRELLLDFYRTSKQRKPKQIIIFRDGVSESQFNQVLNIELEQIIKAYQHLGEADIPKFTVIVAQKNHHTKLFQASGPENVPPGTVVDTRIVHPRNYDFYMCAHAGMIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKAEAGQSPPLPPSPPLMPPNVKPEHVDLPRHSIMSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLYQTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGKRSKHSFQSKTFMVEISFATKIPLRSIALALKGNEVDNTQDALRVLDIVLRQQAANWGCLLVRQSFFHDDSRNLVDVGGGVSGIRGFHSSFRPTQGGLSLNMDVSTTMILKPGPVIDFLIANQNVREPRFIDWTKAKKMLRNLRVKPRHRNMEFKIVGLSEKPCNQQFFPMKVKSTEGTNEGETLEITVYDYFTQHCRIELTYSAYLPCLDVGKPKRPNYLPLELCSLVSLQRYTKALSSMQRASLVEKSRQKPQDRMRTLTDALRSYSYDEDPVLAACGISIGKQLTQVDGRILEIPKLKVGKSEDCIPRNGRWNFNNKRFLEATRIDRWIVVNFSARCDTSHISRELINCGRNKGIHIERPFTLIEEDQQTRRGNPVVRVERMFELITEKLPGPPQFILCVLPERKNSDIYGPWKKKSLSDFGIATQCISPTKINDQYLTNVLLKINSKLGGINSLLALEQSSLIPLIKDTPTMILGMDVSHGSPGRSDIPSVAAVVGSQSWPLISRYRAAVRTQSSKVEMIDALYKPIANGNDDGIIRELLLDFYRTSKQRKPKQIIIFRDGVSESQFNQVLNIELEQIIKAYQHLGEADIPKFTVIVAQKNHHTKLFQASGPENVPPGTVVDTRIVHPRNYDFYMCAHAGMIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein argonaute 6 Involved in transcriptional gene silencing (TGS). Component of the RISC complex that associate with the small interfering RNA (siRNA) pathway involved in direct cytosine methylation at endogenous DNA repeats. Required for the accumulation of specific siRNAs derived from transgene and heterochromatin-related endogenous loci. Involved in RNA-directed DNA methylation (RdDM) at specific endogenous loci. Probably not required for the accumulation of siRNAs derived from transgene inverted repeats that induce post-transcriptional gene silencing (PTGS). Associates mainly with small RNAs of 24 nucleotide in length and preferentially recruits small RNAs with a 5' terminal adenosine. Targeted by turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO6 function in RNA silencing.probableO48771
Protein argonaute 4A Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.probableQ9SDG8
Protein argonaute 16 Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.probableQ6YSJ5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F1N, chain A
Confidence level:very confident
Coverage over the Query: 29-129,163-322,342-832
View the alignment between query and template
View the model in PyMOL