Citrus Sinensis ID: 003355

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------

MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH

ccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHcccccccccccccccccEEEEEccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEECccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHccccccccccEEEEEccccHHHcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*********************GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQ*DKEAG**KGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI********************************************************************************************************MIHL******************VEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLE************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynamin-related protein 3A	Involved in the control of mitochondrial division and morphology.	confident	Q8S944
Dynamin-related protein DNM1	Microtubule-associated force-producing protein that participates mitochondrial fission. Fission of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. Functions antagonistically with FZO1.	probable	P54861
Dynamin-1-like protein	Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. May be involved in vesicle transport.	probable	Q2KIA5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AKA, chain B
Confidence level:very confident
Coverage over the Query: 22-322
View the alignment between query and template
View the model in PyMOL

Template: 3ZVR, chain A
Confidence level:very confident
Coverage over the Query: 21-514,551-637,648-738
View the alignment between query and template
View the model in PyMOL