Citrus Sinensis ID: 003355

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------
MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH
ccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHcccccccccccccccccEEEEEccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHccccccccccEEEEEccccHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHcHHHHHHHcccccccccccEccccEEEEEEEcccHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHccccccEEEEEEEEEEcccccccHHHHHcccEEEEEccEEEEEEccHHHHcccccHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHcccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
madepatnttaaqsqpsavplggsvipLVNKLQDIFAQLgsqstielpqvavvgsqssgkssVLEALvgrdflprgndictrrPLVLQLLQTKTDEeygeflhlpgkrfydfsEIRREIQAQtdkeaggnkgvsdkqirlkifsphvlditlvdlpgitkvpvgeqpaDIEARIRTMIMSYIKQPSClilavtpansdlansdalqiagiadpdgyrtigiitkldimdrgTDARNLLLGKviplrlgyvgvvnrsqedimfNRSIKDALVAEEKFfrsrpvyngladrcgvPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHasygeiteskagQGALLLNILSKYSEAFSSMVegkneemstselsggaRIHYIFQSIFVksleevdpcedltddDIRTAIQnatgpksalfvpdvpfEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFlreglepsetMIGHIIEMEMDyintshpnfigGSKAVEIALQQIksskvplpitrhkdgvepdkapssersLKSRAILARQVNgimadqgvrptvevekvapagntsgsswgissifggsdnrvpagkesvtnkpfsepvqnVEHAFAMIhlrepptilrpseshseqENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTldelpleadsvergynmsadptglpkihglptssmyttssgsndsytaspknpksrksshsgelqshlfsnadsngsgrmympglyptvdh
madepatnttaaqsqpsavpLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFlprgndictrrPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQaqtdkeaggnkgvsdkqirLKIFSPHVLDITLvdlpgitkvpvgeqpADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQiagiadpdgyRTIGIITKLDIMDRGTDARNLLLGkviplrlgyvgvvnrsqedimFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASygeiteskagqGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQnatgpksalfvpDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGnflreglepsETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKsskvplpitrhkdgvepdkapsserslksRAILARQVNGIMADQGVRPTVEVEKVapagntsgsswgisSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQafrtldelpleadsVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLfsnadsngsgrmYMPGLYPTVDH
MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTsgsswgissifggsDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH
*********************GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRRE*****************KQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYS*********************GARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI*************************************VNGIM**********************************************************HAFAMIHL******************VEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEM******************RVLQQAFRT*******************************************************************************************
************************VIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQ*DKEAG**KGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVN****************VAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHA**************LLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGS******************************************************************************************************************************************IAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLE************************************************************************************
****************SAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQ***********SDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSM*************SGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKD*************LKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRP********NVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMY****************************QSHLFSNADSNGSGRMYMPGLYPTVDH
*******************PLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIK*******************************************************************************************************MIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMS*DPT*********************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query827 2.2.26 [Sep-21-2011]
Q8S944808 Dynamin-related protein 3 yes no 0.885 0.905 0.785 0.0
Q8LFT2780 Dynamin-related protein 3 no no 0.894 0.948 0.756 0.0
P54861757 Dynamin-related protein D yes no 0.821 0.896 0.413 1e-166
Q9URZ5678 Vacuolar protein sorting- yes no 0.782 0.954 0.404 1e-157
Q7SXN5691 Dynamin-1-like protein OS yes no 0.804 0.962 0.417 1e-157
Q94464853 Dynamin-A OS=Dictyosteliu yes no 0.597 0.579 0.527 1e-157
O00429736 Dynamin-1-like protein OS yes no 0.846 0.951 0.417 1e-156
Q2KIA5749 Dynamin-1-like protein OS yes no 0.846 0.934 0.408 1e-155
O35303755 Dynamin-1-like protein OS yes no 0.847 0.928 0.410 1e-155
Q8K1M6742 Dynamin-1-like protein OS yes no 0.840 0.936 0.411 1e-154
>sp|Q8S944|DRP3A_ARATH Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2 Back     alignment and function desciption
 Score = 1212 bits (3135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/740 (78%), Positives = 660/740 (89%), Gaps = 8/740 (1%)

Query: 17  SAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG 76
           +A PLG SVIP+VNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct: 29  NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG 88

Query: 77  NDICTRRPLVLQLLQTKT------DEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGN 130
           NDICTRRPLVLQLLQTK+      D+E+GEF HLP  RFYDFSEIRREI+A+T++  G N
Sbjct: 89  NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN 148

Query: 131 KGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLIL 190
           KGV+D QIRLKI SP+VL+ITLVDLPGITKVPVG+QP+DIEARIRTMI+SYIKQ +CLIL
Sbjct: 149 KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL 208

Query: 191 AVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYV 250
           AVTPAN+DLANSDALQIA I DPDG+RTIG+ITKLDIMD+GTDAR LLLG V+PLRLGYV
Sbjct: 209 AVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYV 268

Query: 251 GVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAI 310
           GVVNR QEDI+ NR++K+AL+AEEKFFRS PVY+GLADR GVPQLAKKLNQILVQHIK +
Sbjct: 269 GVVNRCQEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVL 328

Query: 311 LPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMST 370
           LP LKSRIS+ALV+ AKEH SYGE+TES+AGQGALLLN LSKY EA+SS++EGK+EEMST
Sbjct: 329 LPDLKSRISNALVATAKEHQSYGELTESRAGQGALLLNFLSKYCEAYSSLLEGKSEEMST 388

Query: 371 SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLI 430
           SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP+SALFVPDVPFEVL+
Sbjct: 389 SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLV 448

Query: 431 RRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSE 490
           RRQI+RLLDPSLQCARFI++EL+KISH C++NELQRFPVLRKRMDEVIG+FLREGLEPSE
Sbjct: 449 RRQISRLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSE 508

Query: 491 TMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSE 550
            MIG II+MEMDYINTSHPNFIGG+KAVE A+ Q+KSS++P P+ R KD VEPD+  SS 
Sbjct: 509 AMIGDIIDMEMDYINTSHPNFIGGTKAVEAAMHQVKSSRIPHPVARPKDTVEPDRTSSST 568

Query: 551 RSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKE 610
             +KSR+ L RQ NGI+ DQGV  + + EK  PA N S + WGI SIF G D R    K+
Sbjct: 569 SQVKSRSFLGRQANGIVTDQGV-VSADAEKAQPAANASDTRWGIPSIFRGGDTRA-VTKD 626

Query: 611 SVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRK 670
           S+ NKPFSE V+++ H  +MI+L+EPP +LRP+E+HSEQE VEI +TKLLLRSYYDIVRK
Sbjct: 627 SLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRSYYDIVRK 686

Query: 671 NIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVL 730
           NIEDS+PKA+MHFLVNHTKRELHNVFIKKLYRENLFEEMLQEP+E+A+KRKRT++TL VL
Sbjct: 687 NIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRTQETLHVL 746

Query: 731 QQAFRTLDELPLEADSVERG 750
           QQA+RTLDELPLEADSV  G
Sbjct: 747 QQAYRTLDELPLEADSVSAG 766
Involved in the control of mitochondrial division and morphology.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8LFT2|DRP3B_ARATH Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2 Back     alignment and function description
>sp|P54861|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9URZ5|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2 Back     alignment and function description
>sp|Q7SXN5|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1 Back     alignment and function description
>sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 Back     alignment and function description
>sp|O00429|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2 Back     alignment and function description
>sp|Q2KIA5|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1 Back     alignment and function description
>sp|O35303|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1 Back     alignment and function description
>sp|Q8K1M6|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
359494701831 PREDICTED: dynamin-related protein 3A-li 0.996 0.991 0.854 0.0
255584037837 dynamin, putative [Ricinus communis] gi| 0.996 0.984 0.862 0.0
224093258835 predicted protein [Populus trichocarpa] 0.987 0.978 0.841 0.0
296088789923 unnamed protein product [Vitis vinifera] 0.990 0.887 0.830 0.0
224132938821 predicted protein [Populus trichocarpa] 0.952 0.959 0.842 0.0
449459548822 PREDICTED: dynamin-related protein 3A-li 0.990 0.996 0.807 0.0
449511368822 PREDICTED: LOW QUALITY PROTEIN: dynamin- 0.990 0.996 0.805 0.0
449479057817 PREDICTED: dynamin-related protein 3A-li 0.981 0.993 0.827 0.0
356554800823 PREDICTED: dynamin-related protein 3A-li 0.990 0.995 0.802 0.0
356549507826 PREDICTED: dynamin-related protein 3A-li 0.969 0.970 0.811 0.0
>gi|359494701|ref|XP_002269774.2| PREDICTED: dynamin-related protein 3A-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1438 bits (3723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/832 (85%), Positives = 778/832 (93%), Gaps = 8/832 (0%)

Query: 1   MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 60
           MA+E A ++    S  SA PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct: 1   MAEE-AVSSNPTHSSSSAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 59

Query: 61  SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI 115
           SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     ++EEYGEFLHLPGK+F+DFSEI
Sbjct: 60  SSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRRPDGSEEEYGEFLHLPGKKFFDFSEI 119

Query: 116 RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR 175
           RREIQA+TD+EAG NKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct: 120 RREIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR 179

Query: 176 TMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDAR 235
           TMIMSYIK PSCLILAVTPANSDLANSDALQIAG ADPDGYRTIG+ITKLDIMDRGTDAR
Sbjct: 180 TMIMSYIKLPSCLILAVTPANSDLANSDALQIAGNADPDGYRTIGVITKLDIMDRGTDAR 239

Query: 236 NLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQL 295
           NLLLGKVIPLRLGY+GVVNRSQEDI+ NRS+KDALVAEEKFFRSRPVYNGLADRCG+ QL
Sbjct: 240 NLLLGKVIPLRLGYIGVVNRSQEDIIMNRSVKDALVAEEKFFRSRPVYNGLADRCGITQL 299

Query: 296 AKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSE 355
           AKKLNQILVQHIK +LPGLK R++SALVSVAKEHAS GEI ESKAGQGALLLNILSKY+E
Sbjct: 300 AKKLNQILVQHIKTVLPGLKLRMNSALVSVAKEHASIGEIPESKAGQGALLLNILSKYAE 359

Query: 356 AFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 415
           AFSS VEGKNEEMST+ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP
Sbjct: 360 AFSSRVEGKNEEMSTAELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 419

Query: 416 KSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMD 475
           +SALFVP+VPFEVL+RRQIARLLDPSLQCARFIYDEL+KISH CLV+E+QRFP+LRKRMD
Sbjct: 420 RSALFVPEVPFEVLVRRQIARLLDPSLQCARFIYDELVKISHRCLVSEMQRFPILRKRMD 479

Query: 476 EVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPIT 535
           EV+GNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVE+ALQQIKSS++P+P+ 
Sbjct: 480 EVMGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEMALQQIKSSRLPVPVA 539

Query: 536 RHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGIS 595
           R KDG+EPDKAP+SERSLK+RAILAR VNGI+ADQGVRP  +VEK   +G+T+GSSWGIS
Sbjct: 540 RQKDGLEPDKAPTSERSLKARAILARPVNGIVADQGVRPVADVEKFTSSGSTTGSSWGIS 599

Query: 596 SIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIA 655
           SIFGGSDNRV A KE  TNK +SEPVQ+VEH+ +MIHL+EPPTIL+PSESHSEQE +EI+
Sbjct: 600 SIFGGSDNRVSA-KEISTNKTYSEPVQSVEHSISMIHLKEPPTILKPSESHSEQEAIEIS 658

Query: 656 VTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEE 715
           VTKLLLRSYYDIVRKNIED++PKA+MHFLVNHTKRELHNVFI+KLYRENLFEEMLQEP+E
Sbjct: 659 VTKLLLRSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDE 718

Query: 716 VAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNM-SADPTGLPKIHGLPTSSMYTT 774
           VAMKRKRT +TLRVLQQA RTLDELP EA++VE+GY++ S+DPTGLPKIHGLPTSS+YTT
Sbjct: 719 VAMKRKRTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTT 778

Query: 775 SSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVD 826
           S GS  SYTASPKNPKSRKSSHSGELQS    NADSNG GR YMPGLYPT+D
Sbjct: 779 SGGSTQSYTASPKNPKSRKSSHSGELQSPFHGNADSNGGGRSYMPGLYPTLD 830

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255584037|ref|XP_002532763.1| dynamin, putative [Ricinus communis] gi|223527492|gb|EEF29620.1| dynamin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224093258|ref|XP_002309855.1| predicted protein [Populus trichocarpa] gi|222852758|gb|EEE90305.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296088789|emb|CBI38239.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224132938|ref|XP_002327916.1| predicted protein [Populus trichocarpa] gi|222837325|gb|EEE75704.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459548|ref|XP_004147508.1| PREDICTED: dynamin-related protein 3A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511368|ref|XP_004163937.1| PREDICTED: LOW QUALITY PROTEIN: dynamin-related protein 3A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449479057|ref|XP_004155493.1| PREDICTED: dynamin-related protein 3A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356554800|ref|XP_003545730.1| PREDICTED: dynamin-related protein 3A-like [Glycine max] Back     alignment and taxonomy information
>gi|356549507|ref|XP_003543135.1| PREDICTED: dynamin-related protein 3A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
TAIR|locus:2059445809 DRP3B "dynamin related protein 0.467 0.478 0.756 3.3e-288
DICTYBASE|DDB_G0277849853 dymA "dynamin like protein" [D 0.597 0.579 0.505 7e-156
SGD|S000003924757 DNM1 "Dynamin-related GTPase i 0.528 0.577 0.481 8.9e-149
UNIPROTKB|G4N7U4802 MGG_06361 "Dynamin-A" [Magnapo 0.510 0.526 0.489 1.3e-145
ASPGD|ASPL0000044708794 AN8874 [Emericella nidulans (t 0.534 0.556 0.476 2.7e-145
CGD|CAL0000402866 DNM1 [Candida albicans (taxid: 0.528 0.504 0.460 1.9e-144
ASPGD|ASPL0000009085696 vpsA [Emericella nidulans (tax 0.545 0.647 0.466 1e-143
POMBASE|SPAC767.01c678 vps1 "dynamin family protein V 0.522 0.637 0.465 7.1e-141
UNIPROTKB|G4N1E7698 MGG_09517 "Vacuolar protein so 0.524 0.621 0.462 5e-140
ZFIN|ZDB-GENE-040426-1556691 dnm1l "dynamin 1-like" [Danio 0.616 0.738 0.448 1.5e-138
TAIR|locus:2059445 DRP3B "dynamin related protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1472 (523.2 bits), Expect = 3.3e-288, Sum P(3) = 3.3e-288
 Identities = 299/395 (75%), Positives = 339/395 (85%)

Query:    14 SQPSAV-PLGGSVIPLVNKLQDIFAQLGSQSTIELPXXXXXXXXXXXXXXXLEALVGRDF 72
             S  SAV PLG SVIP+VNKLQDIFAQLGSQSTI LP               LEALVGRDF
Sbjct:     9 SSASAVTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKSSVLEALVGRDF 68

Query:    73 LPRGNDICTRRPLVLQLLQTK------TDEEYGEFLHL-PGKRFYDFSEIRREIQAQTDK 125
             LPRGNDICTRRPL LQL+QTK      +DEE+GEFLH  P +R YDFSEIRREI+A+T++
Sbjct:    69 LPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSEIRREIEAETNR 128

Query:   126 EAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQP 185
              +G NKGVSD  I LKIFSP+VLDI+LVDLPGITKVPVG+QP+DIEARIRTMI++YIK+P
Sbjct:   129 VSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARIRTMILTYIKEP 188

Query:   186 SCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPL 245
             SCLILAV+PAN+DLANSDALQIAG ADPDG+RTIG+ITKLDIMDRGTDARN LLGK IPL
Sbjct:   189 SCLILAVSPANTDLANSDALQIAGNADPDGHRTIGVITKLDIMDRGTDARNHLLGKTIPL 248

Query:   246 RLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQ 305
             RLGYVGVVNRSQEDI+ NRSIKDALVAEEKFFRSRPVY+GL DR GVPQLAKKLNQ+LVQ
Sbjct:   249 RLGYVGVVNRSQEDILMNRSIKDALVAEEKFFRSRPVYSGLTDRLGVPQLAKKLNQVLVQ 308

Query:   306 HIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKN 365
             HIKA+LP LKSRI++AL + AKE+ SYG+ITES+ GQGALLL+ ++KY EA+SS +EGK+
Sbjct:   309 HIKALLPSLKSRINNALFATAKEYESYGDITESRGGQGALLLSFITKYCEAYSSTLEGKS 368

Query:   366 EEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDL 400
             +EMSTSELSGGARI YIFQS+FVKSLE +  C  L
Sbjct:   369 KEMSTSELSGGARILYIFQSVFVKSLEVITVCRYL 403
GO:0003924 "GTPase activity" evidence=IEA;ISS
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0016559 "peroxisome fission" evidence=IMP
GO:0000266 "mitochondrial fission" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0009791 "post-embryonic development" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
DICTYBASE|DDB_G0277849 dymA "dynamin like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000003924 DNM1 "Dynamin-related GTPase involved in mitochondrial organization" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4N7U4 MGG_06361 "Dynamin-A" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044708 AN8874 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0000402 DNM1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009085 vpsA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC767.01c vps1 "dynamin family protein Vps1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4N1E7 MGG_09517 "Vacuolar protein sorting-associated protein 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1556 dnm1l "dynamin 1-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K1M6DNM1L_MOUSE3, ., 6, ., 5, ., 50.41130.84030.9366yesno
Q8S944DRP3A_ARATHNo assigned EC number0.78510.88510.9059yesno
P54861DNM1_YEAST3, ., 6, ., 5, ., 50.41390.82100.8969yesno
O35303DNM1L_RAT3, ., 6, ., 5, ., 50.41020.84760.9284yesno
O00429DNM1L_HUMAN3, ., 6, ., 5, ., 50.41740.84640.9510yesno
Q8LFT2DRP3B_ARATHNo assigned EC number0.75630.89480.9487nono
Q2KIA5DNM1L_BOVIN3, ., 6, ., 5, ., 50.40890.84640.9345yesno
Q7SXN5DNM1L_DANRE3, ., 6, ., 5, ., 50.41760.80410.9623yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00001878001
SubName- Full=Chromosome undetermined scaffold_123, whole genome shotgun sequence; (828 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 1e-130
pfam01031296 pfam01031, Dynamin_M, Dynamin central region 1e-127
smart00053240 smart00053, DYNc, Dynamin, GTPase 1e-107
pfam00350168 pfam00350, Dynamin_N, Dynamin family 3e-60
COG0699546 COG0699, COG0699, Predicted GTPases (dynamin-relat 6e-47
pfam0221290 pfam02212, GED, Dynamin GTPase effector domain 4e-32
smart0030292 smart00302, GED, Dynamin GTPase effector domain 3e-28
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-04
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 5e-04
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information 
 Score =  390 bits (1004), Expect = e-130
 Identities = 169/278 (60%), Positives = 213/278 (76%), Gaps = 10/278 (3%)

Query: 45  IELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKT------DEEY 98
           I+LPQ+ VVG QSSGKSSVLEALVGRDFLPRG+ ICTRRPL LQL ++ +       EE+
Sbjct: 1   IDLPQIVVVGDQSSGKSSVLEALVGRDFLPRGSGICTRRPLELQLRRSPSESDEDEKEEW 60

Query: 99  GEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGI 158
           GEFLHL  K F DF E+R EI+ +TD+ AG NKG+S + IRL+I SP V ++TLVDLPG+
Sbjct: 61  GEFLHLKSKEFTDFEELREEIEKETDRVAGENKGISPEPIRLEIESPDVPNLTLVDLPGL 120

Query: 159 TKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRT 218
            KVPVG+QP DIE +IR+M+ SYI  P  +ILAV PAN DLANS+AL++A   DP+G RT
Sbjct: 121 IKVPVGDQPEDIEEQIRSMVKSYISNPRSIILAVVPANVDLANSEALKLAREVDPEGERT 180

Query: 219 IGIITKLDIMDRGTDARNLLL---GKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEK 275
           IG++TKLD+MD GTDA ++LL   GKVIPL+LGYVGVVNRSQ+DI   +SI++AL AEE+
Sbjct: 181 IGVLTKLDLMDPGTDAEDILLLLQGKVIPLKLGYVGVVNRSQKDIDSGKSIEEALEAEEE 240

Query: 276 FFRSRPVYN-GLADRCGVPQLAKKLNQILVQHIKAILP 312
           FF + P Y    A R G P L K+L+++L +HI+  LP
Sbjct: 241 FFETHPWYKLLPASRVGTPALRKRLSKLLQKHIRESLP 278

The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner. Length = 278
>gnl|CDD|216255 pfam01031, Dynamin_M, Dynamin central region Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>gnl|CDD|202159 pfam02212, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|128597 smart00302, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 827
KOG0446657 consensus Vacuolar sorting protein VPS1, dynamin, 100.0
PF01031295 Dynamin_M: Dynamin central region; InterPro: IPR00 100.0
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 100.0
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 100.0
smart0030292 GED Dynamin GTPase effector domain. 99.94
PF0221292 GED: Dynamin GTPase effector domain; InterPro: IPR 99.88
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.87
COG0699546 Predicted GTPases (dynamin-related) [General funct 99.61
PRK09866741 hypothetical protein; Provisional 99.61
COG0218200 Predicted GTPase [General function prediction only 99.59
COG1159298 Era GTPase [General function prediction only] 99.53
COG0486454 ThdF Predicted GTPase [General function prediction 99.5
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.46
COG1160444 Predicted GTPases [General function prediction onl 99.45
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.44
PRK00089292 era GTPase Era; Reviewed 99.38
COG1160444 Predicted GTPases [General function prediction onl 99.36
COG3596296 Predicted GTPase [General function prediction only 99.36
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.35
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.34
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.31
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.3
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 99.3
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.26
PRK11058426 GTPase HflX; Provisional 99.26
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.25
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.25
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.25
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.25
PRK00093435 GTP-binding protein Der; Reviewed 99.24
COG1084346 Predicted GTPase [General function prediction only 99.23
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.23
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.23
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.23
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.22
PRK03003472 GTP-binding protein Der; Reviewed 99.21
PRK03003472 GTP-binding protein Der; Reviewed 99.21
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.21
PRK15494339 era GTPase Era; Provisional 99.2
PRK12299335 obgE GTPase CgtA; Reviewed 99.2
PRK12298390 obgE GTPase CgtA; Reviewed 99.19
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.18
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.18
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.18
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.17
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.17
COG2262411 HflX GTPases [General function prediction only] 99.16
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.15
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.15
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.14
PRK12296500 obgE GTPase CgtA; Reviewed 99.14
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.13
PRK00093435 GTP-binding protein Der; Reviewed 99.12
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.12
PRK04213201 GTP-binding protein; Provisional 99.11
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.11
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 99.11
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.1
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.1
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.09
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.08
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.08
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.08
PRK12297424 obgE GTPase CgtA; Reviewed 99.07
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.06
PRK09554772 feoB ferrous iron transport protein B; Reviewed 99.06
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.05
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.04
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.04
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.04
cd00881189 GTP_translation_factor GTP translation factor fami 99.04
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.02
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.99
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.99
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.99
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.99
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.98
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.97
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.96
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.96
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.95
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.95
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.95
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.95
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.94
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.94
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.94
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.93
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.93
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.93
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.93
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.93
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.92
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.92
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.92
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.91
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.91
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.9
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.9
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.9
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.9
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.88
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.88
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.87
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.87
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.87
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.86
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.86
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.85
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.85
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.85
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.85
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.84
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.84
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.84
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.84
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.83
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.83
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.83
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.83
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.83
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.83
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.83
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.83
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.82
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.82
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.81
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.8
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.79
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.79
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.79
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.79
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.78
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.76
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.76
PTZ00369189 Ras-like protein; Provisional 98.76
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.75
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.75
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 98.75
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.75
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.75
cd01896233 DRG The developmentally regulated GTP-binding prot 98.74
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.74
PLN03108210 Rab family protein; Provisional 98.73
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.73
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.73
PLN03110216 Rab GTPase; Provisional 98.73
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.73
PLN03118211 Rab family protein; Provisional 98.72
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.72
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.71
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.71
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.71
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.71
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.7
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.7
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.7
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.7
TIGR00475581 selB selenocysteine-specific elongation factor Sel 98.7
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.7
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.69
CHL00189742 infB translation initiation factor 2; Provisional 98.68
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.68
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.68
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.67
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.66
PLN00223181 ADP-ribosylation factor; Provisional 98.66
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.66
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 98.65
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.65
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.65
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.65
PTZ00133182 ADP-ribosylation factor; Provisional 98.65
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.64
PRK05306787 infB translation initiation factor IF-2; Validated 98.63
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.63
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.62
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.62
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.61
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.6
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.59
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.59
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.58
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.58
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.57
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 98.57
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.55
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.55
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.55
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.54
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.54
COG0536369 Obg Predicted GTPase [General function prediction 98.53
PRK12317425 elongation factor 1-alpha; Reviewed 98.53
PRK04004586 translation initiation factor IF-2; Validated 98.53
TIGR00484689 EF-G translation elongation factor EF-G. After pep 98.52
cd04105203 SR_beta Signal recognition particle receptor, beta 98.52
PLN03127447 Elongation factor Tu; Provisional 98.51
PRK05433600 GTP-binding protein LepA; Provisional 98.51
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.51
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.51
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.5
CHL00071409 tufA elongation factor Tu 98.5
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.48
PRK00007693 elongation factor G; Reviewed 98.47
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.46
PRK12739691 elongation factor G; Reviewed 98.45
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.45
COG1100219 GTPase SAR1 and related small G proteins [General 98.45
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.45
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 98.43
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.42
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.41
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.41
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.41
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.39
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 98.38
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.37
PRK00741526 prfC peptide chain release factor 3; Provisional 98.37
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.37
PRK12736394 elongation factor Tu; Reviewed 98.36
KOG0093193 consensus GTPase Rab3, small G protein superfamily 98.36
PRK00049396 elongation factor Tu; Reviewed 98.34
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.34
PLN03126478 Elongation factor Tu; Provisional 98.33
PRK12735396 elongation factor Tu; Reviewed 98.33
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.33
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.32
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.32
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.32
TIGR00485394 EF-Tu translation elongation factor TU. This align 98.32
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.32
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 98.31
PRK10218607 GTP-binding protein; Provisional 98.31
COG5019373 CDC3 Septin family protein [Cell division and chro 98.3
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 98.3
TIGR00503527 prfC peptide chain release factor 3. This translat 98.3
PTZ00258390 GTP-binding protein; Provisional 98.29
KOG2486320 consensus Predicted GTPase [General function predi 98.29
PLN00023334 GTP-binding protein; Provisional 98.27
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 98.26
PRK09601364 GTP-binding protein YchF; Reviewed 98.25
PRK13351687 elongation factor G; Reviewed 98.24
PTZ00416836 elongation factor 2; Provisional 98.23
PRK07560731 elongation factor EF-2; Reviewed 98.23
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.22
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.21
KOG0078207 consensus GTP-binding protein SEC4, small G protei 98.21
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 98.2
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.19
PLN00116843 translation elongation factor EF-2 subunit; Provis 98.17
PRK04000411 translation initiation factor IF-2 subunit gamma; 98.16
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 98.13
COG2229187 Predicted GTPase [General function prediction only 98.13
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.11
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.1
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.1
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.1
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.1
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.1
COG1163365 DRG Predicted GTPase [General function prediction 98.09
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.04
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.04
PRK09602396 translation-associated GTPase; Reviewed 98.01
KOG0095213 consensus GTPase Rab30, small G protein superfamil 97.98
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 97.96
PRK12740668 elongation factor G; Reviewed 97.96
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 97.95
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.94
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.93
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 97.89
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.87
KOG0410410 consensus Predicted GTP binding protein [General f 97.86
PLN00043447 elongation factor 1-alpha; Provisional 97.82
PTZ00141446 elongation factor 1- alpha; Provisional 97.81
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.81
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.78
PRK09563287 rbgA GTPase YlqF; Reviewed 97.78
PRK09435332 membrane ATPase/protein kinase; Provisional 97.77
KOG0080209 consensus GTPase Rab18, small G protein superfamil 97.76
KOG1145683 consensus Mitochondrial translation initiation fac 97.76
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.73
PRK12288347 GTPase RsgA; Reviewed 97.73
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.72
PRK13768253 GTPase; Provisional 97.71
PRK12289352 GTPase RsgA; Reviewed 97.7
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 97.69
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.67
KOG0091213 consensus GTPase Rab39, small G protein superfamil 97.67
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.67
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.65
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.65
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.64
COG0480697 FusA Translation elongation factors (GTPases) [Tra 97.62
COG1161322 Predicted GTPases [General function prediction onl 97.6
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 97.6
KOG0079198 consensus GTP-binding protein H-ray, small G prote 97.59
KOG4252246 consensus GTP-binding protein [Signal transduction 97.59
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.58
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 97.58
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 97.56
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.55
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.54
PRK10416318 signal recognition particle-docking protein FtsY; 97.52
PRK13796365 GTPase YqeH; Provisional 97.5
KOG0090238 consensus Signal recognition particle receptor, be 97.48
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.48
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.46
KOG0394210 consensus Ras-related GTPase [General function pre 97.46
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 97.46
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.43
KOG0098216 consensus GTPase Rab2, small G protein superfamily 97.42
PRK14974336 cell division protein FtsY; Provisional 97.38
PRK00098298 GTPase RsgA; Reviewed 97.38
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.37
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 97.33
COG1162301 Predicted GTPases [General function prediction onl 97.32
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 97.31
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.29
cd03112158 CobW_like The function of this protein family is u 97.29
PRK10867433 signal recognition particle protein; Provisional 97.28
COG0012372 Predicted GTPase, probable translation factor [Tra 97.28
TIGR00064272 ftsY signal recognition particle-docking protein F 97.25
cd03114148 ArgK-like The function of this protein family is u 97.25
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 97.24
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.19
COG3276447 SelB Selenocysteine-specific translation elongatio 97.18
KOG0395196 consensus Ras-related GTPase [General function pre 97.18
PRK00771437 signal recognition particle protein Srp54; Provisi 97.18
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.17
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.13
KOG0462650 consensus Elongation factor-type GTP-binding prote 97.12
KOG0086214 consensus GTPase Rab4, small G protein superfamily 97.09
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 97.04
cd03115173 SRP The signal recognition particle (SRP) mediates 96.98
KOG0088218 consensus GTPase Rab21, small G protein superfamil 96.97
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 96.94
KOG0461522 consensus Selenocysteine-specific elongation facto 96.94
COG1217603 TypA Predicted membrane GTPase involved in stress 96.91
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.9
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.85
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 96.79
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 96.78
KOG1491391 consensus Predicted GTP-binding protein (ODN super 96.76
TIGR00959428 ffh signal recognition particle protein. This mode 96.76
PRK148451049 translation initiation factor IF-2; Provisional 96.74
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.69
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.68
PF05879742 RHD3: Root hair defective 3 GTP-binding protein (R 96.67
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.63
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 96.62
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.57
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 96.52
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 96.5
PTZ00099176 rab6; Provisional 96.47
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.43
COG0050394 TufB GTPases - translation elongation factors [Tra 96.42
KOG0097215 consensus GTPase Rab14, small G protein superfamil 96.42
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.36
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 96.28
KOG3883198 consensus Ras family small GTPase [Signal transduc 96.14
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.05
KOG2484435 consensus GTPase [General function prediction only 96.04
KOG0464753 consensus Elongation factor G [Translation, riboso 95.81
KOG1143591 consensus Predicted translation elongation factor 95.78
KOG0458603 consensus Elongation factor 1 alpha [Translation, 95.73
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 95.58
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 95.56
PRK01889356 GTPase RsgA; Reviewed 95.53
COG5257415 GCD11 Translation initiation factor 2, gamma subun 95.53
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 95.49
KOG0081219 consensus GTPase Rab27, small G protein superfamil 95.46
KOG0780483 consensus Signal recognition particle, subunit Srp 95.44
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 95.23
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 95.18
KOG2203772 consensus GTP-binding protein [General function pr 95.07
KOG2423572 consensus Nucleolar GTPase [General function predi 95.05
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 94.98
KOG4181491 consensus Uncharacterized conserved protein [Funct 94.95
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 94.3
PRK11537318 putative GTP-binding protein YjiA; Provisional 94.21
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 94.17
COG5258527 GTPBP1 GTPase [General function prediction only] 94.15
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.04
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.91
PF1355562 AAA_29: P-loop containing region of AAA domain 93.9
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.79
KOG0463641 consensus GTP-binding protein GP-1 [General functi 93.76
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 93.74
COG1101263 PhnK ABC-type uncharacterized transport system, AT 93.61
KOG0467 887 consensus Translation elongation factor 2/ribosome 93.53
PRK13695174 putative NTPase; Provisional 93.46
COG4619223 ABC-type uncharacterized transport system, ATPase 93.43
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.36
COG0523323 Putative GTPases (G3E family) [General function pr 93.33
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 93.3
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 93.21
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.17
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.11
COG1341398 Predicted GTPase or GTP-binding protein [General f 93.09
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 92.92
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 92.92
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 92.81
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 92.69
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 92.6
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 92.53
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.49
KOG2749415 consensus mRNA cleavage and polyadenylation factor 92.47
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.4
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.36
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 92.29
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.28
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 92.21
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 92.19
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 91.99
PRK00300205 gmk guanylate kinase; Provisional 91.94
COG3910233 Predicted ATPase [General function prediction only 91.9
KOG0460449 consensus Mitochondrial translation elongation fac 91.89
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.82
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 91.64
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.62
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 91.61
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 91.52
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 91.39
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 91.38
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 91.38
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 91.3
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 91.29
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 91.22
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 91.19
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.14
cd03215182 ABC_Carb_Monos_II This family represents domain II 91.12
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 91.08
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.07
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 91.04
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 91.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 90.99
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 90.91
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 90.89
COG4988559 CydD ABC-type transport system involved in cytochr 90.88
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 90.88
PRK09563287 rbgA GTPase YlqF; Reviewed 90.87
PRK13851344 type IV secretion system protein VirB11; Provision 90.84
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 90.83
COG0410237 LivF ABC-type branched-chain amino acid transport 90.83
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 90.78
cd03269210 ABC_putative_ATPase This subfamily is involved in 90.77
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 90.75
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 90.73
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 90.73
PRK14737186 gmk guanylate kinase; Provisional 90.72
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 90.7
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 90.7
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 90.7
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 90.67
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 90.62
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 90.61
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.59
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 90.58
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 90.55
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 90.49
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 90.49
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 90.46
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 90.46
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 90.45
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 90.41
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 90.41
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 90.37
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 90.35
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 90.3
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 90.29
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 90.28
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 90.27
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 90.23
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 90.21
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 90.19
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 90.17
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 90.16
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 90.15
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 90.13
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.12
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 90.08
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 90.07
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 90.07
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 90.04
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 90.03
COG4559259 ABC-type hemin transport system, ATPase component 89.99
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 89.98
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 89.96
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 89.94
PRK10908222 cell division protein FtsE; Provisional 89.94
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 89.89
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 89.87
COG3523 1188 IcmF Type VI protein secretion system component Va 89.86
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 89.86
COG1126240 GlnQ ABC-type polar amino acid transport system, A 89.83
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 89.83
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 89.82
cd03246173 ABCC_Protease_Secretion This family represents the 89.82
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 89.81
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-106  Score=943.95  Aligned_cols=649  Identities=41%  Similarity=0.600  Sum_probs=582.2

Q ss_pred             CCCCchHHHHHHHHHHHHHhCCCCCCCCCEEEEEccCCCCHHHHHHHHhCCCCCccCCCccccceEEEEeeccCCC-ccc
Q 003355           20 PLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTD-EEY   98 (827)
Q Consensus        20 ~~~~~~~~~~~~l~d~~~~~g~~~~~~lP~IvVvG~qssGKSSlLnaL~G~~~lP~~~g~~Tr~p~~l~l~~~~~~-~~~   98 (827)
                      ..+..+++++|+++|.+..+|....+++|+|+|||.||+||||+||+|+|++|||||.|+|||||++++|.+.... .+|
T Consensus         2 ~~~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~   81 (657)
T KOG0446|consen    2 GLMRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEE   81 (657)
T ss_pred             chhhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCcccc
Confidence            3678899999999999999997778999999999999999999999999999999999999999999999988654 799


Q ss_pred             ceee-cCCCccccChHHHHHHHHHhhhhhcCCCCcccccceEEEEecCCcccEEEEeCCCCCcCCCCCCchHHHHHHHHH
Q 003355           99 GEFL-HLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTM  177 (827)
Q Consensus        99 ~~~~-~~~g~~~~d~~~i~~~i~~~t~~~~g~~~~~s~~~i~l~i~~p~~~~ltLVDlPGi~~~~~~~q~~di~~~i~~l  177 (827)
                      ++|. |.+++.++||++++++|..+|++.+|.++|+|+.+|.++|++|+++++|||||||++++++++||.|++.++++|
T Consensus        82 ~~f~~h~~~~~~~D~~~vrkeI~~et~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~m  161 (657)
T KOG0446|consen   82 ASFLTHDKKKRFTDFEEVRKEIRSETDRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSM  161 (657)
T ss_pred             hhccccccccccCCHHHHHHHHHhhHHHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHH
Confidence            9999 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCccEEEeecCCCCcccchHHHHHHHHhCCCCCceEEeeecCCCCCCcccHHHhhccccccccceEEEEEcCCc
Q 003355          178 IMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQ  257 (827)
Q Consensus       178 v~~yi~~~~~iIL~V~~a~~d~~~~d~l~la~~~dp~g~rtIgVlTK~D~~~~~~~~~~~l~~~~~~l~lG~~~V~nrs~  257 (827)
                      ++.|+.++++|||+|++||+|+++++++++|+++||.|.|||||+||+|++++|+++..+|.|..+++++||++|+||+|
T Consensus       162 i~~yi~~~~~iILav~~an~d~ats~alkiarevDp~g~RTigvitK~DlmdkGt~~~~~L~g~~~~l~~g~v~vvnR~q  241 (657)
T KOG0446|consen  162 IEEYIEKPNRIILAVTPANSDIATSPALVVAREVDPGGSRTLEVITKFDFMDKGTNAVTRLVGRPITLKVGYVGVVNRSQ  241 (657)
T ss_pred             HHHhccccchhhhhccchhhhhhcCHHHHHHHhhCCCccchhHHhhhHHhhhcCCcceeeecCCccccccceeeeeccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhHHHHHHHHHhhccCCCccccccccCCchHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHhcCCCCC
Q 003355          258 EDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITE  337 (827)
Q Consensus       258 ~d~~~~~s~~~~~~~E~~fF~~~~~~~~~~~~~Gi~~L~~~L~~~L~~~I~~~LP~l~~~i~~~l~~~~~el~~lg~~~~  337 (827)
                      ++++.++++.+++..|..||.+||.|..+.+++|+++|.++|+.+|..||+.++|.|+..|+.++.+.++++..||. ..
T Consensus       242 ~di~~~k~~~~al~~e~~~f~~~p~y~~~~~~~g~p~La~~L~~~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~-~~  320 (657)
T KOG0446|consen  242 SIIDFKKSILEALNDEVPSFESVPSYPILLTISGVPYLALLLPGYLQSHIRDQLPELKTKINKLLEKYQDELNRIGA-VD  320 (657)
T ss_pred             hhhhhhhhHHHHHHhhhhhhhccccccccccccCcchHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcc-cC
Confidence            99999999999999999999999999999888999999999999999999999999999999999999999999997 33


Q ss_pred             ChhhHHHHHHHHHHHHHHHhhhhccCcccccccccccccchHHHHHHHHHHHhhhhcCCCCCCchHHHHHHHHhhcCCCC
Q 003355          338 SKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKS  417 (827)
Q Consensus       338 ~~~~~~~~l~~~i~~f~~~~~~~i~G~~~~~~~~~l~ggari~~~f~~~F~~~l~~~~~~~~l~~~dI~~~i~n~~G~~~  417 (827)
                      ........++.++..|+..|...+.|..+...+.+++|||||+|+|++.|...+..++|.+.+...+|++++.|++|+++
T Consensus       321 ~~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~  400 (657)
T KOG0446|consen  321 VDLANSAALLAIIREDPRGLRTGVIGKLDLVPTKALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRP  400 (657)
T ss_pred             CccchhhHHHHHHHHHHHHHHHhhcccccccchhcccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCc
Confidence            34445678899999999999999999988755889999999999999999999999999999999999999999999999


Q ss_pred             CCCCCChhHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHHHHhhhh-ccCcchHHHHHHHHHHHHHHHHhHhhHHHHHHHH
Q 003355          418 ALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVN-ELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHI  496 (827)
Q Consensus       418 ~lfvp~~~Fe~Lvk~qI~~l~~Psl~c~~~V~~el~~i~~~~~~~-~~~rfp~L~~~i~~~v~~~l~~~~~~a~~~i~~l  496 (827)
                      ++|+|+.+||.+|++||+++++|+++|++.|+++|.+++++|... +|.|||.|+..+.+++.+++++++.+++++|.++
T Consensus       401 ~lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~el~~~~~~~~~~~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~  480 (657)
T KOG0446|consen  401 SLFVPESSFESLVKGQIQSLRDPSLKCVEEVHRELVRIVADSIRATELKRFPVLYSELVEIASSLIAEGLDETKKAVKNL  480 (657)
T ss_pred             cccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHH
Confidence            999999999999999999999999999999999999999999876 8999999999999999999999999999999999


Q ss_pred             HHHHhcccCCCCCCCccchH-HHHHHHHhhhhcCCCCCccccCCCCCCCCCCCcchhhhhHHHHHhhhcccccCCCCCcc
Q 003355          497 IEMEMDYINTSHPNFIGGSK-AVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPT  575 (827)
Q Consensus       497 i~~E~~yInT~hpdF~~~~~-a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  575 (827)
                      |+||.+||||.||||+++.+ |+......  +.+       ..                         .+.. +.     
T Consensus       481 i~~e~~yinT~h~df~~~~~~al~~~~~~--~~~-------~~-------------------------~~~~-~~-----  520 (657)
T KOG0446|consen  481 IDLEQSYLNTDHPDFRSLTDSALSSVTSP--SIA-------AM-------------------------KLIS-AQ-----  520 (657)
T ss_pred             HHHHHHHhcCcChhhhhhHHHHHHHhhcc--ccc-------cc-------------------------cccc-cc-----
Confidence            99999999999999999875 43221110  000       00                         0000 00     


Q ss_pred             hhhcccCCCCCCCCCCCccccccCCCCCCCCCCCCccCCCCCCCCchhhhhhHhhhccCCCCccCCCCCCCchhHHHHHH
Q 003355          576 VEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIA  655 (827)
Q Consensus       576 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~l~~~~~~s~~e~~ei~  655 (827)
                          . ..  ......++....+.+.                          ...+.+...+..+.....+++++..+++
T Consensus       521 ----~-~~--~~~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~  567 (657)
T KOG0446|consen  521 ----L-LK--EELGECNSALKAIKNA--------------------------VGSIRLDPSDIVLSRALVLKKRECKETE  567 (657)
T ss_pred             ----c-cc--cccccccchhhhhcch--------------------------hhhhhhcccchhhhhhhhcchhhhHHHH
Confidence                0 00  0000000000001000                          0001222233344444567788899999


Q ss_pred             HHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHhc-hhhHhhhcCCCHHHHHHHHHHHHHHHHHHHHH
Q 003355          656 VTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYR-ENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAF  734 (827)
Q Consensus       656 ~ir~ll~SYf~IVrK~i~D~VPKaImhfLVn~~k~~Lq~eLi~~Ly~-~~~~~~LL~E~~~ia~kR~~~~~~l~~L~~A~  734 (827)
                      .|+.++.|||+||+|+|+|+|||+|||||||.+++.||++|+++||+ .+.+++||+|+|.++++|+.|++|+++|++|.
T Consensus       568 ~i~~~~~sY~~iv~~~i~d~vpk~i~~~lv~~~k~~l~~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~~~l~~L~~a~  647 (657)
T KOG0446|consen  568 EISSCPESYLNIVSDKLVDTVPKALNHELLNEFKDDLPNELDQRLYAGDEQLESLLKEDPRIKRRRELQQKRLLALQKAL  647 (657)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHccCHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999 99999999999999999999999999999999


Q ss_pred             HHHccccc
Q 003355          735 RTLDELPL  742 (827)
Q Consensus       735 ~~L~~i~~  742 (827)
                      .+|..+..
T Consensus       648 ~ii~~~~~  655 (657)
T KOG0446|consen  648 SILATVAQ  655 (657)
T ss_pred             HHHHHHhc
Confidence            99988764

>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>smart00302 GED Dynamin GTPase effector domain Back     alignment and domain information
>PF02212 GED: Dynamin GTPase effector domain; InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 1e-129
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 8e-04
3zvr_A772 Crystal Structure Of Dynamin Length = 772 1e-129
3zvr_A772 Crystal Structure Of Dynamin Length = 772 6e-04
3zyc_A353 Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gm 5e-99
3l43_A319 Crystal Structure Of The Dynamin 3 Gtpase Domain Bo 9e-97
2x2e_A353 Dynamin Gtpase Dimer, Long Axis Form Length = 353 5e-96
2aka_B299 Structure Of The Nucleotide-Free Myosin Ii Motor Do 6e-96
1jwy_B315 Crystal Structure Of The Dynamin A Gtpase Domain Co 4e-95
3t34_A360 Arabidopsis Thaliana Dynamin-Related Protein 1a (At 7e-69
3zys_B662 Human Dynamin 1 Deltaprd Polymer Stabilized With Gm 1e-47
3szr_A608 Crystal Structure Of Modified Nucleotide-Free Human 2e-47
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure 
Iteration: 1

 Score =  459 bits (1181), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/494 (46%), Positives = 327/494 (66%), Gaps = 4/494 (0%)
Query: 25  VIPLVNKLQDIFAQLGSQSTIELPXXXXXXXXXXXXXXXLEALVGRDFLPRGNDICTRRP 84
           +IPLVN+LQD F+ +G  + ++LP               LE  VGRDFLPRG+ I TRRP
Sbjct: 6   LIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRP 65
Query: 85  LVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFS 144
           LVLQL+   T  EY EFLH  GK+F DF E+R EI+A+TD+  G NKG+S   I L+++S
Sbjct: 66  LVLQLVNATT--EYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYS 123
Query: 145 PHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDA 204
           PHVL++TLVDLPG+TKVPVG+QP DIE +IR M+M ++ + +CLILAV+PANSDLANSDA
Sbjct: 124 PHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDA 183
Query: 205 LQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNR 264
           L++A   DP G RTIG+ITKLD+MD GTDAR++L  K++PLR GY+GVVNRSQ+DI   +
Sbjct: 184 LKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKK 243
Query: 265 SIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVS 324
            I  AL AE KFF S P Y  LADR G P L K LNQ L  HI+  LPGL++++ S L+S
Sbjct: 244 DITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLS 303
Query: 325 VAKEHASYGEIT-ESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIF 383
           + KE   Y     +  A +   LL ++ +++  F   +EG  +++ T ELSGGARI+ IF
Sbjct: 304 IEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIF 363
Query: 384 QSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQ 443
              F   L +++  E     +I  AI+NA    + LF PD+ FE ++++Q+ ++ +P L+
Sbjct: 364 HERFPFELVKMEFDEKELRREISYAIKNAAAAATGLFTPDMAFETIVKKQVKKIREPCLK 423
Query: 444 CARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDY 503
           C   +  EL+     C   +LQ++P LR+ M+ ++   +RE    ++  +  +I++E+ Y
Sbjct: 424 CVDMVISELISTVRQC-TKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAY 482
Query: 504 INTSHPNFIGGSKA 517
           +NT+H +FIG + A
Sbjct: 483 MNTNHEDFIGFANA 496
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3ZYC|A Chain A, Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gmppcp Length = 353 Back     alignment and structure
>pdb|3L43|A Chain A, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound With Gdp Length = 319 Back     alignment and structure
>pdb|2X2E|A Chain A, Dynamin Gtpase Dimer, Long Axis Form Length = 353 Back     alignment and structure
>pdb|2AKA|B Chain B, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 299 Back     alignment and structure
>pdb|1JWY|B Chain B, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 315 Back     alignment and structure
>pdb|3T34|A Chain A, Arabidopsis Thaliana Dynamin-Related Protein 1a (Atdrp1a) In Prefission State Length = 360 Back     alignment and structure
>pdb|3ZYS|B Chain B, Human Dynamin 1 Deltaprd Polymer Stabilized With Gmppcp Length = 662 Back     alignment and structure
>pdb|3SZR|A Chain A, Crystal Structure Of Modified Nucleotide-Free Human Mxa Length = 608 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 0.0
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 1e-178
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 3e-16
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 1e-150
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 1e-145
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 1e-144
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 1e-139
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 1e-38
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 6e-10
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 2e-05
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
 Score =  683 bits (1764), Expect = 0.0
 Identities = 281/770 (36%), Positives = 419/770 (54%), Gaps = 37/770 (4%)

Query: 1   MADEPATNTTAAQSQPSAVPLG----GSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQ 56
           M      +  ++   P    +G      +IPLVN+LQD F+ +G  + ++LPQ+AVVG Q
Sbjct: 1   MGSSHHHHHHSSGLVPRGSHMGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQ 60

Query: 57  SSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIR 116
           S+GKSSVLE  VGRDFLPRG+ I TRRPLVLQL    +  EY EFLH  GK+F DF E+R
Sbjct: 61  SAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL--VNSTTEYAEFLHCKGKKFTDFEEVR 118

Query: 117 REIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRT 176
            EI+A+TD+  G NKG+S   I L+++SPHVL++TLVDLPG+TKVPVG+QP DIE +IR 
Sbjct: 119 LEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRD 178

Query: 177 MIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARN 236
           M+M ++ + +CLILAV+PANSDLANSDAL+IA   DP G RTIG+ITKLD+MD GTDAR+
Sbjct: 179 MLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARD 238

Query: 237 LLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLA 296
           +L  K++PLR GY+GVVNRSQ+DI   + I  AL AE KFF S P Y  LADR G P L 
Sbjct: 239 VLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQ 298

Query: 297 KKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGE-ITESKAGQGALLLNILSKYSE 355
           K LNQ L  HI+  LPGL++++ S L+S+ KE   Y     +  A +   LL ++ +++ 
Sbjct: 299 KVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAV 358

Query: 356 AFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 415
            F   +EG  +++ T ELSGGARI+ IF   F   L +++  E     +I  AI+N    
Sbjct: 359 DFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHDI 418

Query: 416 KSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMD 475
           ++ LF PD+ FE  +++Q+ +L +PS++C   +  EL      C   +LQ++P LR+ M+
Sbjct: 419 RTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCS-EKLQQYPRLREEME 477

Query: 476 EVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPIT 535
            ++   +RE    ++  +  +I++E+ Y+NT+H +FIG + A + + Q  K         
Sbjct: 478 RIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE 537

Query: 536 RHKDGVEPDKAPSSERSLKSRAI---------LARQVNGIMADQGVRPTVEVEKVAPAGN 586
                       +                   L+   +    ++    +V+  K+     
Sbjct: 538 ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEK 597

Query: 587 TSGSSWGISSIFGGSDN-----------------RVPAGKESVTNKPFSEPVQNVEHAFA 629
              SS  I ++F                       V + K S             +   +
Sbjct: 598 GFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKAS 657

Query: 630 MIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTK 689
                   + +        Q   ++   + L+ SY  IV K + D +PK +MH ++N+TK
Sbjct: 658 ETEENGSDSFMHSM---DPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTK 714

Query: 690 RELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDE 739
             + +  +  LY       +++E  E A +R         L++A   + +
Sbjct: 715 EFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGD 764
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Length = 271 Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Length = 271 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 100.0
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 100.0
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 100.0
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 100.0
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 100.0
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 100.0
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 100.0
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.73
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.41
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.41
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.39
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.39
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.36
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.35
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.32
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.26
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.22
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.19
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.19
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.19
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.18
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.17
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.17
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.15
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.14
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.13
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.13
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.13
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.13
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.12
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.12
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.11
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.11
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.1
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.1
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.1
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.09
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.07
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.07
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.07
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.07
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.07
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.07
2ged_A193 SR-beta, signal recognition particle receptor beta 99.07
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.07
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.06
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.06
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.06
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.06
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.06
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.06
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.06
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.06
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.06
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.05
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.05
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.05
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.05
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.04
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.04
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.04
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.03
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.03
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.03
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.03
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.03
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.03
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.03
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.03
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.03
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.02
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.02
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.02
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.02
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.02
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.01
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.01
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.01
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.01
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.01
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.0
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.0
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.99
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.99
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.99
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.99
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.99
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.98
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.98
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.98
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.98
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.97
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.97
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.97
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.97
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.97
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.96
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.95
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.95
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.95
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.94
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.94
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.94
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.94
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.94
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.93
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.92
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.92
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.92
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.92
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.91
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.91
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.9
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.9
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.9
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.9
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.89
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.89
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.89
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.88
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.88
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.87
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.87
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.87
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.86
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.86
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.86
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.85
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.84
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.84
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.84
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.83
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.8
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.8
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.79
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.77
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.77
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.75
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.75
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.74
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.73
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.72
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.71
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.71
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.71
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.7
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 98.68
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.67
1wb1_A482 Translation elongation factor SELB; selenocysteine 98.67
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.11
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.63
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.63
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.63
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.62
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.62
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.61
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.6
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.59
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.58
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.57
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.55
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.55
3izy_P537 Translation initiation factor IF-2, mitochondrial; 98.54
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.54
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.53
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.52
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 98.49
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 98.48
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.48
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.46
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.43
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.42
2xex_A693 Elongation factor G; GTPase, translation, biosynth 98.41
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 98.41
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 98.39
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 98.38
1f60_A458 Elongation factor EEF1A; protein-protein complex, 98.38
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.36
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.35
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.33
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.33
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.32
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.31
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.28
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.28
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 98.27
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.25
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.23
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 98.22
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 98.2
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.2
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.19
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.16
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.16
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.15
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.12
2dy1_A665 Elongation factor G; translocation, GTP complex, s 98.09
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.08
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.06
3vqt_A548 RF-3, peptide chain release factor 3; translation, 98.06
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 98.06
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.02
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.99
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.93
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.91
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.89
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.87
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.85
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 97.83
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 97.82
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.8
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 97.67
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.66
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.58
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.55
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.51
2xxa_A433 Signal recognition particle protein; protein trans 97.42
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.39
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.37
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.26
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.26
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.23
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.13
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.09
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.89
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.72
2og2_A359 Putative signal recognition particle receptor; nuc 96.38
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.17
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.06
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 94.56
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 93.21
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.81
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.46
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.36
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.35
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.2
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.14
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.06
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.95
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.89
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.72
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.69
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.62
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.58
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 91.57
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 91.49
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.49
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.45
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.45
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.42
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.36
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 91.33
2oap_1511 GSPE-2, type II secretion system protein; hexameri 91.33
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.32
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.29
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.18
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.14
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.96
1g6h_A257 High-affinity branched-chain amino acid transport 90.93
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.92
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.89
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.81
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.8
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.72
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 90.66
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.59
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.55
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 90.52
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.51
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 90.4
2ghi_A260 Transport protein; multidrug resistance protein, M 90.39
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 90.38
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.29
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 90.2
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 90.17
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.14
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.06
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.04
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.01
3kta_A182 Chromosome segregation protein SMC; structural mai 89.83
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.7
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 89.68
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.37
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.31
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 89.23
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.17
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 89.09
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 88.96
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 88.94
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.8
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.75
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.43
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.38
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 88.38
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 88.37
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 88.22
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.17
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.03
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.87
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 87.74
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 87.72
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 87.64
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 87.46
1p9r_A418 General secretion pathway protein E; bacterial typ 87.43
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 87.35
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 87.32
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 87.23
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 87.16
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 87.16
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 87.05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 86.93
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 86.83
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 86.82
1xjc_A169 MOBB protein homolog; structural genomics, midwest 86.78
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 86.7
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.67
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 86.64
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.56
2ewv_A372 Twitching motility protein PILT; pilus retraction 86.39
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 86.39
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 86.1
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 86.08
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.94
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 85.91
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 85.89
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 85.84
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 85.83
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 85.75
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 85.68
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.25
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.94
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 84.92
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 84.88
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 84.83
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 84.75
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 84.73
2kjq_A149 DNAA-related protein; solution structure, NESG, st 84.72
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 84.67
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 84.52
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 84.45
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 84.08
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 84.08
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 84.07
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 83.44
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 83.39
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 83.28
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 83.23
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 83.12
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 83.12
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 82.87
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 82.83
3vaa_A199 Shikimate kinase, SK; structural genomics, center 82.65
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 82.47
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.16
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 82.16
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 82.01
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 81.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 81.92
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 81.9
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 81.78
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 81.73
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 81.7
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 81.47
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 81.46
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 81.38
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 81.35
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 81.34
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 81.3
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 81.17
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 81.15
1via_A175 Shikimate kinase; structural genomics, transferase 81.06
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 80.84
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 80.78
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 80.78
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 80.75
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 80.73
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 80.63
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 80.62
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 80.59
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 80.48
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 80.48
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 80.23
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 80.19
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
Probab=100.00  E-value=3.1e-112  Score=1010.00  Aligned_cols=705  Identities=40%  Similarity=0.642  Sum_probs=570.9

Q ss_pred             CCCchHHHHHHHHHHHHHhCCCCCCCCCEEEEEccCCCCHHHHHHHHhCCCCCccCCCccccceEEEEeeccCCCcccce
Q 003355           21 LGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGE  100 (827)
Q Consensus        21 ~~~~~~~~~~~l~d~~~~~g~~~~~~lP~IvVvG~qssGKSSlLnaL~G~~~lP~~~g~~Tr~p~~l~l~~~~~~~~~~~  100 (827)
                      -++++++++|+|+|.|+.+|....+++|+|+|||.+|+|||||||+|+|.+|||++.++|||||+++++.+.+  .+|++
T Consensus        25 ~~~~li~~inkl~d~l~~lg~~~~i~lp~I~vvG~~saGKSSllnaL~g~~~LP~g~g~~Tr~Pl~l~l~~~~--~~~~~  102 (772)
T 3zvr_A           25 GMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNST--TEYAE  102 (772)
T ss_dssp             CGGGHHHHHHHHHHHHHTTTCCGGGCCSEEEEEECTTTCHHHHHHHHHSSCCSCCSSSCSCSSCEEEEEEECS--SCEEE
T ss_pred             cHHHHHHHHHHHHHHHHhcCccccCCCCEEEEECCCCCcHHHHHHHHhCCCccCcCCccccccceEEEeecCC--cchhh
Confidence            4689999999999999999998889999999999999999999999999999999999999999999998875  48999


Q ss_pred             eecCCCccccChHHHHHHHHHhhhhhcCCCCcccccceEEEEecCCcccEEEEeCCCCCcCCCCCCchHHHHHHHHHHHH
Q 003355          101 FLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMS  180 (827)
Q Consensus       101 ~~~~~g~~~~d~~~i~~~i~~~t~~~~g~~~~~s~~~i~l~i~~p~~~~ltLVDlPGi~~~~~~~q~~di~~~i~~lv~~  180 (827)
                      +.+..++.+.++++++.++...++...|.+++|+.+++.++|++|++++++||||||+.+.+.++||.++...+.+++..
T Consensus       103 ~l~~~~~~~~~~~~v~~~I~~~~~~~~g~~~~is~~~i~l~I~~P~~~qL~LVDTPGi~~~~~~~qp~di~~~i~~lv~~  182 (772)
T 3zvr_A          103 FLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQ  182 (772)
T ss_dssp             CSTTTTCCBCCHHHHHHHHHHHHHHHHCSTTCCCSCCEEEEEEETTCCSEEEEECCCCCCCCSSCCCCHHHHHHHHHHHH
T ss_pred             eeccCCcccCCHHHHHHHHHHHHhhhcCCCCcccccceEEEEecCCCCceEEEECCCcccCCCCCCcHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999988889999999999999999


Q ss_pred             HhcCCccEEEeecCCCCcccchHHHHHHHHhCCCCCceEEeeecCCCCCCcccHHHhhccccccccceEEEEEcCCchhh
Q 003355          181 YIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDI  260 (827)
Q Consensus       181 yi~~~~~iIL~V~~a~~d~~~~d~l~la~~~dp~g~rtIgVlTK~D~~~~~~~~~~~l~~~~~~l~lG~~~V~nrs~~d~  260 (827)
                      |+....++||+|++++.++..++.+.+++.+++.+.|+|+|+||+|+++++....+++.++..++++||+.|+++|+.+.
T Consensus       183 yi~~~aDlIL~VVDAs~~~~~~d~l~ll~~L~~~g~pvIlVlNKiDlv~~~~~~~~il~~~~~~l~lg~~~VV~iSA~~G  262 (772)
T 3zvr_A          183 FVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDI  262 (772)
T ss_dssp             HHTSTTEEEEEEEETTSCSSSCHHHHHHHHHCTTCSSEEEEEECTTSSCTTCCSHHHHTTCSSCCSSCEEECCCCCCEES
T ss_pred             HHhcCCcEEEEEEcCCCCcchhHHHHHHHHHHhcCCCEEEEEeCcccCCcchhhHHHHHHHhhhhhccCCceEEeccccc
Confidence            99988889999999999999999889999999999999999999999988877777777777888999999999999988


Q ss_pred             hhhhhHHHHHHHHHhhccCCCccccccccCCchHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHhcCCCCCCh-
Q 003355          261 MFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESK-  339 (827)
Q Consensus       261 ~~~~s~~~~~~~E~~fF~~~~~~~~~~~~~Gi~~L~~~L~~~L~~~I~~~LP~l~~~i~~~l~~~~~el~~lg~~~~~~-  339 (827)
                      .....+.+++..|..||..+|+|..+.+++|+..|.+.|.+.|..||++.||.++.+|+.++..++.+++++|+++++. 
T Consensus       263 ~GvdeL~eaI~~e~~ffpe~P~yd~ltDr~g~~~LaEiLrEkL~~hi~~ELP~l~~~I~~~l~s~~vele~~~~~~~~~~  342 (772)
T 3zvr_A          263 DGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDP  342 (772)
T ss_dssp             SSSEEHHHHHHHHHHHHHHCTTTGGGGGGCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSS
T ss_pred             ccchhHHHHHHHHHHhccCCcchhhhhhcccHHHHHHHHHHHHHHHHHhhCccHHHHHHHHHHHHHHHHHHhCCCCCCCh
Confidence            7777899999999999999999988889999999999999999999999999999999999999999999999876544 


Q ss_pred             hhHHHHHHHHHHHHHHHhhhhccCcccccccccccccchHHHHHHHHHHHhhhhcCCCCCCchHHHHHHHHhhcCCCCCC
Q 003355          340 AGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSAL  419 (827)
Q Consensus       340 ~~~~~~l~~~i~~f~~~~~~~i~G~~~~~~~~~l~ggari~~~f~~~F~~~l~~~~~~~~l~~~dI~~~i~n~~G~~~~l  419 (827)
                      .++..+|++++++|++.|.++|+|.++++.+.++.|||||+++|++.|...+..+++.+.+++.+|+++|+|++|+++++
T Consensus       343 ~~~~~~ll~~~~~f~~~~~~~i~G~~~~~~~~el~ggari~~if~~~f~~~~~~~~~~~~~~~~~I~~~i~n~~G~~~~l  422 (772)
T 3zvr_A          343 ARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHDIRTGL  422 (772)
T ss_dssp             SCSHHHHHHHHHHHHHHHHHHHTC---------CCHHHHHHHHHHTHHHHHHHTTSCCHHHHHHHHHHHHHHCC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCCCCcCcccCCCCeeeehhHHHHhHHHHhcCCCchhhhHHHHHHHHHhCCCCCCCC
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCChhHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHHHHhhhhccCcchHHHHHHHHHHHHHHHHhHhhHHHHHHHHHHH
Q 003355          420 FVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEM  499 (827)
Q Consensus       420 fvp~~~Fe~Lvk~qI~~l~~Psl~c~~~V~~el~~i~~~~~~~~~~rfp~L~~~i~~~v~~~l~~~~~~a~~~i~~li~~  499 (827)
                      |+|+.+||.||++||++|++||++|++.|++||.+++++|. .+|.|||.|++++.+++.++|++++.+|+++|.+||+|
T Consensus       423 f~p~~~fe~LVk~QI~rl~ePsl~CVdlV~~eL~~iv~~~~-~~l~RfP~Lr~ei~~iv~~~Lre~~~~t~~~V~~LId~  501 (772)
T 3zvr_A          423 FTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCS-EKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDI  501 (772)
T ss_dssp             CHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHG-GGGTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999995 78999999999999999999999999999999999999


Q ss_pred             HhcccCCCCCCCccchHHHHHHHHhhhhcCCCCCccccCCCCCCCCCCCcchhhhhHHHHHhhhcccccCCC--------
Q 003355          500 EMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQG--------  571 (827)
Q Consensus       500 E~~yInT~hpdF~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------  571 (827)
                      |++||||+||||+|+++|+..+.+..++...+..               ....+..++|+..++.+.+.+++        
T Consensus       502 E~ayintnHpdf~~~~~~~~~~~~~~~~~~~~~~---------------~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~  566 (772)
T 3zvr_A          502 ELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ---------------DEILVIRKGWLTINNIGIMKGGSKEYWFVLT  566 (772)
T ss_dssp             HHTCCCTTCTTCCCC------------------------------------CCEEEEEEEEESSSCCC---CCEEEEEEE
T ss_pred             hcCCCCCCChhhhchHHHHHHHHHHhhcccccCC---------------ccccceeeeeeeecccccccCCCccceeecc
Confidence            9999999999999999988665543332211000               00013344554444444332221        


Q ss_pred             ------CCcchhhccc--CCC-----CCCCCCCC---ccccccCCCCCCCCCCCCccCCCCCCCCchhhhhhHhh-hccC
Q 003355          572 ------VRPTVEVEKV--APA-----GNTSGSSW---GISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAM-IHLR  634 (827)
Q Consensus       572 ------~~~~~~~~~~--~~~-----~~~~~~~~---~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~-~~l~  634 (827)
                            |+...+.++.  .+.     ++...+++   ++..+|+... ++.+ |+..+.....+..++.+++.+. .+.+
T Consensus       567 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~~  644 (772)
T 3zvr_A          567 AENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQ-RNVY-KDYRQLELACETQEEVDSWKASFLRAG  644 (772)
T ss_dssp             SSEEEEESSTTCCCEEEEEECTTEEEEEC-------CEEEEEEETTS-SCSB-TTBSEEEEEESSHHHHHHHHHHHHHTT
T ss_pred             ccccccccchhhhcccccccccccccchhhhccccccccccccCCcc-cccc-chhhhhhhhccccccchhhHHhhhhcc
Confidence                  1111122221  011     11111122   3445666543 3333 5554444444444444333221 2333


Q ss_pred             CCC---------------ccCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHH
Q 003355          635 EPP---------------TILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKK  699 (827)
Q Consensus       635 ~~p---------------~~l~~~~~~s~~e~~ei~~ir~ll~SYf~IVrK~i~D~VPKaImhfLVn~~k~~Lq~eLi~~  699 (827)
                      .+|               ..+.....+++++.+||++||+||+|||+||+|+|+|+|||||||||||++|++||+||+++
T Consensus       645 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~q~e~~~~l~~sy~~iv~k~~~d~~pk~im~~~vn~~k~~~~~el~~~  724 (772)
T 3zvr_A          645 VYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLAN  724 (772)
T ss_dssp             CCBC------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTHHHH
T ss_pred             cCCccccccccccccCCccccccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333               34444445678999999999999999999999999999999999999999999999999999


Q ss_pred             HhchhhHhhhcCCCHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
Q 003355          700 LYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEAD  745 (827)
Q Consensus       700 Ly~~~~~~~LL~E~~~ia~kR~~~~~~l~~L~~A~~~L~~i~~~~~  745 (827)
                      ||+.+.+++||+|++++++||++|.+|+++|++|+++|++|+..+-
T Consensus       725 ly~~~~~~~lm~Es~~~~~~r~~~~~~~~~l~~a~~ii~~i~~~~~  770 (772)
T 3zvr_A          725 LYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTV  770 (772)
T ss_dssp             HHHTCCTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHC-------
T ss_pred             HhcccCHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Confidence            9999999999999999999999999999999999999999987654
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 827
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 1e-101
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 2e-96
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

 Score =  313 bits (803), Expect = e-101
 Identities = 179/305 (58%), Positives = 236/305 (77%), Gaps = 7/305 (2%)

Query: 24  SVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRR 83
            +IP++NKLQD+F  LGS   ++LPQ+ VVGSQSSGKSSVLE +VGRDFLPRG+ I TRR
Sbjct: 2   QLIPVINKLQDVFNTLGSD-PLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR 60

Query: 84  PLVLQLLQTKT------DEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQ 137
           PL+LQL            +E+GEFLH P   FYDFSEIR EI   TD+  G NKG+S + 
Sbjct: 61  PLILQLTHLPIADDGSQTQEWGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKNKGISAQP 120

Query: 138 IRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANS 197
           I LKI+SPHV+++TLVDLPGITKVPVG+QP DIE +IR M+M+YIK+ + +I+AVTPAN+
Sbjct: 121 INLKIYSPHVVNLTLVDLPGITKVPVGDQPTDIEQQIRRMVMAYIKKQNAIIVAVTPANT 180

Query: 198 DLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQ 257
           DLANSDALQ+A   DP+G RTIG+ITKLD+MD+GTDA  +L G+VIPL LG++GV+NRSQ
Sbjct: 181 DLANSDALQLAKEVDPEGKRTIGVITKLDLMDKGTDAMEVLTGRVIPLTLGFIGVINRSQ 240

Query: 258 EDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSR 317
           EDI+  +SI+++L +E  +F++ P+Y  +A+R G   L+K LN++L+ HI+  LP LK +
Sbjct: 241 EDIIAKKSIRESLKSEILYFKNHPIYKSIANRSGTAYLSKTLNKLLMFHIRDTLPDLKVK 300

Query: 318 ISSAL 322
           +S  L
Sbjct: 301 VSKML 305
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 100.0
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 100.0
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.49
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.44
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.4
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.37
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.34
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.32
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.31
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.26
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.26
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.22
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.19
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.16
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.14
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.03
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.95
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.95
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.91
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.9
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.88
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.83
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.82
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.79
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.78
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.77
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.75
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.72
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.72
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.71
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.7
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.67
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.65
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.63
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.62
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.62
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.6
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.59
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.58
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.55
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.55
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.52
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.5
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.48
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.48
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.47
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.46
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.45
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.43
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.42
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.41
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.4
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.25
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.17
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.1
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.06
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.04
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.92
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.92
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.87
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.86
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 97.83
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.72
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.64
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.59
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.48
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.48
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.46
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.41
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.32
d1okkd2207 GTPase domain of the signal recognition particle r 97.27
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.23
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.07
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.97
d2qy9a2211 GTPase domain of the signal recognition particle r 96.81
d1vmaa2213 GTPase domain of the signal recognition particle r 96.58
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.01
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.45
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 94.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.84
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.83
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.65
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.38
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.93
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.47
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.46
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.41
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.31
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.27
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.14
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.66
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.44
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.37
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.11
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.09
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.96
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.94
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.9
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 89.9
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.85
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 89.82
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.7
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.62
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.56
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.35
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.22
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.21
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 89.14
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.11
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.95
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 88.18
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 88.09
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.96
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.6
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 87.54
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.28
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 87.11
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 86.79
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 86.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.4
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.17
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.15
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 85.91
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.45
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 85.21
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 84.81
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.63
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 84.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 84.43
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 84.43
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.41
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.24
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 84.21
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.13
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.02
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.94
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 83.9
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.51
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 83.47
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.3
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 82.94
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.5
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 81.66
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 81.65
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 81.21
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 80.98
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 80.95
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 80.04
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.5e-46  Score=402.95  Aligned_cols=299  Identities=62%  Similarity=0.993  Sum_probs=279.5

Q ss_pred             CCchHHHHHHHHHHHHHhCCCCCCCCCEEEEEccCCCCHHHHHHHHhCCCCCccCCCccccceEEEEeeccCCCccccee
Q 003355           22 GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEF  101 (827)
Q Consensus        22 ~~~~~~~~~~l~d~~~~~g~~~~~~lP~IvVvG~qssGKSSlLnaL~G~~~lP~~~g~~Tr~p~~l~l~~~~~~~~~~~~  101 (827)
                      |+++++++|+|+|.++.+|.+..+++|+|||||.+|+|||||||||+|.++||++.++|||+|+++++.....  .+..+
T Consensus         1 ~~~~~~~~~~l~d~l~~lg~~~~~~~P~ivvvG~~SsGKSsliNaLlg~~~lP~~~~~~T~~~~~i~~~~~~~--~~~~~   78 (299)
T d2akab1           1 MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTT--EYAEF   78 (299)
T ss_dssp             CTTHHHHHHHHHHHHTTSCCCTTCCCCEEEEEEBTTSCHHHHHHHHHTSCCSCCCSSCSCSSCEEEEEEECSS--CEEEE
T ss_pred             CHhHHHHHHHHHHHHHHcCCCCCCCCCeEEEEcCCCCCHHHHHHHHhCCCcCCCCCCccccCCEEEEEecccc--ceeEE
Confidence            6899999999999999999999999999999999999999999999999999999999999999999876643  55666


Q ss_pred             ecCCCccccChHHHHHHHHHhhhhhcCCCCcccccceEEEEecCCcccEEEEeCCCCCcCCCCCCchHHHHHHHHHHHHH
Q 003355          102 LHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSY  181 (827)
Q Consensus       102 ~~~~g~~~~d~~~i~~~i~~~t~~~~g~~~~~s~~~i~l~i~~p~~~~ltLVDlPGi~~~~~~~q~~di~~~i~~lv~~y  181 (827)
                      .+.+++...+++++..++........+...+++...+.+++++|..++++||||||+......+++......+.+++..|
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~p~~~~l~liD~PG~~~~~~~~~~~~~~~~i~~~~~~y  158 (299)
T d2akab1          79 LHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQF  158 (299)
T ss_dssp             TTSTTCCBCCHHHHHHHHHHHHHHHCSSTTCCCSCCEEEEEEETTCCSEEEEECCCBCSSCCSSSCTTHHHHHHHHHHHH
T ss_pred             EeCCCCeeCCHHHHHHHHHHHHHHhhCCCcCcCCccEEEEEcCCCCCCeeEEccCCccccccCCcchhHHHHHHHHHHHH
Confidence            67778888999999999988888888888999999999999999999999999999999888888777778899999999


Q ss_pred             hcCCccEEEeecCCCCcccchHHHHHHHHhCCCCCceEEeeecCCCCCCcccHHHhhccccccccceEEEEEcCCchhhh
Q 003355          182 IKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIM  261 (827)
Q Consensus       182 i~~~~~iIL~V~~a~~d~~~~d~l~la~~~dp~g~rtIgVlTK~D~~~~~~~~~~~l~~~~~~l~lG~~~V~nrs~~d~~  261 (827)
                      +.+++++|++|.+++.++++++++.+++.+++.+.|+++|+||+|..+++++....+.+...++..+|+++.++++.+..
T Consensus       159 ~~~~~~~il~v~~a~~~~~~~~~~~~~~~~~~~~~r~i~Vltk~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (299)
T d2akab1         159 VTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDID  238 (299)
T ss_dssp             HTSTTEEEEEEEESSSCGGGCHHHHHHHHHCTTCSSEEEEEECGGGSCTTCCCHHHHTTCSSCCTTCEEECCCCCCBCTT
T ss_pred             hcCccceeeeecccccchhhhHHHHHHHHhCcCCCceeeEEeccccccchhhHHHHHhcccccccCCeeeeecCcccccc
Confidence            99999999999999999999999999999999999999999999999988888888899999999999999999999888


Q ss_pred             hhhhHHHHHHHHHhhccCCCccccccccCCchHHHHHHHHHHHHHHHhhccchHHHHHHHH
Q 003355          262 FNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSAL  322 (827)
Q Consensus       262 ~~~s~~~~~~~E~~fF~~~~~~~~~~~~~Gi~~L~~~L~~~L~~~I~~~LP~l~~~i~~~l  322 (827)
                      ...+..+++..|.+||..+++|..+.+++|+.+|+++|+++|.+||++.||.++.+|+++|
T Consensus       239 ~~~~~~~~~~~E~~~f~~~~~~~~l~~~~gi~~L~~~L~~~L~~~i~~~lp~i~~~i~~~L  299 (299)
T d2akab1         239 GKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQL  299 (299)
T ss_dssp             SCBCHHHHHHHHHHHHHHCTTTGGGGGGCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             ccCCHHHHHHHHHHHHhcCccccchHHhhCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            8889999999999999999999999999999999999999999999999999999988764
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure