Citrus Sinensis ID: 003422


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-
MAELQSGGGGGCCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEMARKLRFFKEQMLKAGILSSVKSTTRADNNTDDLEVKLGDLEAELVEINANGDKLQRAHSELVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLGFIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERAKNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQFEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQDALERAAFDSNSQVGAIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQGQSYEALQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDDEDE
cccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHcccEEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEECcccccccccccccccEEEEEEEEEEcHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEECccccHHHHHHHHHHHcccccccCEEEEEcccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
*****************LFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEMARKLRFFKEQMLKAGILS************DDLEVKLGDLEAELVEINANGDKLQRAHSELVEYKLVLQKAGEFFSSALTS***************MTIETPL**********SKQIKLGFIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERAKNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQFEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQDALERAAFDSNSQVGAIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKM*******************************HEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELQSGGGGGCCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEMARKLRFFKEQMLKAGILSSVKSTTRADNNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHSELVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLGFIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERAKNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQFEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQDALERAAFDSNSQVGAIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQGQSYEALQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDDEDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar proton ATPase a3 Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase. Involved in vacuolar nutrient storage (e.g. accumulation and storage of nitrate) and in tolerance to some toxic ions (e.g. zinc ions sequestration in vacuoles).confidentQ8W4S4
V-type proton ATPase subunit a Subunit of the integral membrane V0 complex of vacuolar ATPase essential for assembly and catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableO13742
V-type proton ATPase subunit a, vacuolar isoform Subunit of the integral membrane V0 complex of vacuolar ATPase essential for assembly and catalytic activity. Is present only in vacuolar V-ATPase complexes. Enzymes containing this subunit have a 4-fold higher ratio of proton transport to ATP hydrolysis than complexes containing the Golgi/endosomal isoform and undergo reversible dissociation of V1 and V0 in response to glucose depletion. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableP32563

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RRK, chain A
Confidence level:very confident
Coverage over the Query: 24-151,171-179,191-225,238-374
View the alignment between query and template
View the model in PyMOL
Template: 2NVJ, chain A
Confidence level:confident
Coverage over the Query: 715-739
View the alignment between query and template
View the model in PyMOL