Citrus Sinensis ID: 003495

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----

MSGRHEKEKGVNVQLCSMRQSGPNGELPPEAGVIPRAVQQIFDTLESQNAEYSVKVTFLELYNEEITDLLAPDEISRAAVEDKQKKQLPLMEDGKGGVLVRGLEEEIVTSASEIFTLLERGSAKRRTAETLLNKQSSRSHSLFSITIHIKEATPEGEELIKCGKLNLVDLAGSENISRSGAREGRAREAGEINKSLLTLGRVINALVEHLGHIPYRDSKLTRLLRDSLGGRTKTCIIATVSPAVHCLEETLSTLDYAHRAKNIKNKPEVYAAREKNGVYIPKERYYQEESERKSNLDQTIKLLNNTEEQLKKCQYALKEKDFIISEQKKAGREDKLNADNRSVVENFQVELAQQIGSLCDIVDLSTCQQNEHLKHVEKLCHSLLGIHEKAVIDLKKKVTASRALYCSHMEAVQNVVRLHKACSNANLEEISAFASSNSESIKEFLASEAREAASIYENLQTTLSTQQGEMAIFAREMRQRFQVTIERTKDIAEYTNGFLQKLLEESKSLENYAVQADENQMKSIADFQKAYEDQTKSDTEKLIADVTSLVSSHMRRQTELVEARLVDFRENAVSSKLFLDGHASSVEGITTDAKRKWQAFAMQADNDAKDGADHSSAKHCRMELLLQECVNSGESAFGHWKRTYESVNEMESKHVSSMISLTRNASYSNEQHDVEVDTARVATEEEVAKSSEDALQLIASASEQEQASIAEVLDDVKAHEKTINLFRESHSAQSASIKEKAQETFQQRYMDYEHTGTTPTRCESEVPSKGTIESLRAMPMETLLEEFRENNSYESFDVKELKPSLIPRSPLSQIN

cccHHHHHcccccEEEEcccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEHHccccccccccccccHHHHHHHHccccccccccccccEEEccccEEEcccHHHHHHHHHHHHcccHHHHHcccccccccccEEEEEEEEEEccccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccHHcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccc

**GRHEKEKGVNVQLCSMRQSGPNGELPPEAGVIPRAVQQIFDTLESQNAEYSVKVTFLELYNEEITDLLAPDEIS**************MEDGKGGVLVRGLEEEIVTSASEIFTLLERGSAKRRTAETLLNKQSSRSHSLFSITIHIKEATPEGEELIKCGKLNLVDLAGSENI***********EAGEINKSLLTLGRVINALVEHLGHIPYRDSKLTRLLRDSLGGRTKTCIIATVSPAVHCLEETLSTLDYAHRAKNIKNKPEVYAAREKNGVYIPKERYY***************LL*****QLKKCQYALKEKDFII******************VVENFQVELAQQIGSLCDIVDLSTCQQNEHLKHVEKLCHSLLGIHEKAVIDLKKKVTASRALYCSHMEAVQNVVRLHKACSNANLEEI************************IYENLQTTLSTQQGEMAIFAREMRQRFQVTIERTKDIAEYTNGFLQKLLE***************************************ADVTSLV*******TELVEARLVDFRENAVSSKLFLDGHASSVEGITTDAKRKWQAF*******************CRMELLLQECVNSGESAFGHWKRTY********************************************************************************************************YMDYEHTGTTPTRCESEVPSKGTI************************************SPL****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSGRHEKEKGVNVQLCSMRQSGPNGELPPEAGVIPRAVQQIFDTLESQNAEYSVKVTFLELYNEEITDLLAPDEISRAAVEDKQKKQLPLMEDGKGGVLVRGLEEEIVTSASEIFTLLERGSAKRRTAETLLNKQSSRSHSLFSITIHIKEATPEGEELIKCGKLNLVDLAGSENISRSGAREGRAREAGEINKSLLTLGRVINALVEHLGHIPYRDSKLTRLLRDSLGGRTKTCIIATVSPAVHCLEETLSTLDYAHRAKNIKNKPEVYAAREKNGVYIPKERYxxxxxxxxxxxxxxxxxxxxxEEQLKKCQYALKEKDFIISEQKKAGREDKLNADNRSVVENFQVELAQQIGSLCDIVDLSTCQQNEHLKHVEKLCHSLLGIHEKAVIDLKKKVTASRALYCSHMEAVQNVVRLHKACSNANLEEISAFASSNSESIKEFLASEAREAASIYENLQTTLSTQQGEMAIFAREMRQRFQVTIERTKDIAEYTNGFxxxxxxxxxxxxxxxxxxxxxQMKSIADFQKAYEDQTKSDTEKLIADVTSLVSSHMRRQTELVEARLVDFRENAVSSKLFLDGHASSVEGITTDAKRKWQAFAMQADNDAKDGADHSSAKHCRMELLLQECVNSGESAFGHWKRTYESVNEMESKHVSSMISLTRNASYSNEQHDVEVDTARVATEEEVAKSSEDALQLIASASEQEQASIAEVLDDVKAHEKTINLFRESHSAQSASIKEKAQETFQQRYMDYEHTGTTPTRCESEVPSKGTIESLRAMPMETLLEEFRENNSYESFDVKELKPSLIPRSPLSQIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable 125 kDa kinesin-related protein	Responsible for microtubule translocation. May be important for the organization of phragmoplast-specific arrays of microtubules.	probable	P82266

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X88, chain A
Confidence level:very confident
Coverage over the Query: 20-175,191-268
View the alignment between query and template
View the model in PyMOL

Template: 2OWM, chain A
Confidence level:very confident
Coverage over the Query: 28-175,190-274
View the alignment between query and template
View the model in PyMOL