Citrus Sinensis ID: 003501

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----

MADTTTMSNVEDRPSKTLKRKRAWPALTGEDKESRIRRFNEEVKWLFGYYKEMITNQRLTIDLSECAGSLNGMVAALMEESELPLTKLVEEIHVKLKENGSEKLGVGLAAVKSAVLFVGQRVMYGVSNADTDILEDDAEASLWCWETRDVKLLPKSVRGSLRIRRTFRKKIHERITAVSAMITALQKSESDPSFINDLMKASKKLGKVLSEASIRVLVDSMLKKNGAEIVEKDAKREEKILIKQLEKNKREVEKEKKRMDCEQQKEKLHSERELKRLQEEAERDERRREKEEADIRKQIRKQQEEADKEQRHREKEEAEMKKKLALQKQASMMERFLKRSKILTSCQNDESSPRAITSVLLSKNSEQLPEAVTKLVDSTLSSNDEINIDDIRRSHLSSWHRFGHFVRSNRNQHWGIRRKPKTELFKELKLTNRGLGHDDDLSMERSEDRCEAQTVDDKSCITSSDSSSAITKCKRWKQLLQFDKSHRPAFYGIWPKKSHIVGPRHPLMKDPDLDYDIDSDEEWEEEEPGESLSDCEKDGDEEGCSKADDEDESEDGFFVPDGYLSEDEGVQVDRMEIDLSAEDTKSSPSYKQELESKESCALVRQRKYLSSLTEQALQKNQPLIILNLMHEKVPLLMAEDLSGTSNMEQKCLQALSIRPFPGDLHVEITVDIMDDENEKDCLSNGKGSTTLISESDLPAIVSVIQSCSTNMNKILEALQQKFPSISRAQLRNKVREISDFNFAENRWQVKREILIELGYSPDKNGGRAKGIATFFSKRCLPPDGKSLNPNEASPLSSLKPGSAVHGQHGCTYNGL

cccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccccccHHcccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccccccccHHHHccccEEEECccccccccEECcccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEcHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********************************IRRFNEEVKWLFGYYKEMITNQRLTIDLSECAGSLNGMVAALMEESELPLTKLVEEIHVKLKENGSEKLGVGLAAVKSAVLFVGQRVMYGVSNADTDILEDDAEASLWCWETRDVKLLPKSVRGSLRIRRTFRKKIHERITAVSAMITAL*******************LGKVLSEASIRVLVDSML*******************************************************************************************************************************************************************INIDDIRRSHLSSWHRFGHFVRSNRNQHWGIRRK**TELFK********************************************TKCKRWKQLLQFDKSHRPAFYGIWPKKSHIVGPRHPLMKDPDLDYDIDSDEEW******************************EDGFFVPDGYLSED********************************CALVRQRKYLSSLTEQALQKNQPLIILNLMHEKVPLLMAEDLSGTSNMEQKCLQALSIRPFPGDLHVEITVD**********************ESDLPAIVSVIQSCSTNMNKILEALQQKFPSISRAQLRNKVREISDFNFAENRWQVKREILIELGYS********K*********C************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MADTTTMSNVEDRPSKTLKRKRAWPALTGEDKESRIRRFNEEVKWLFGYYKEMITNQRLTIDLSECAGSLNGMVAALMEESELPLTKLVEEIHVKLKENGSEKLGVGLAAVKSAVLFVGQRVMYGVSNADTDILEDDAEASLWCWETRDVKLLPKSVRGSLRIRRTFRKKIHERITAVSAMITALQKSESDPSFINDLMKASKKLGKVLSEASIRVLVDSMLKKNGAEIVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKLALQKQASMMERFLKRSKILTSCQNDESSPRAITSVLLSKNSEQLPEAVTKLVDSTLSSNDEINIDDIRRSHLSSWHRFGHFVRSNRNQHWGIRRKPKTELFKELKLTNRGLGHDDDLSMERSEDRCEAQTVDDKSCITSSDSSSAITKCKRWKQLLQFDKSHRPAFYGIWPKKSHIVGPRHPLMKDPDLDYDIDSDEEWEEEEPGESLSDCEKDGDEEGCSKADDEDESEDGFFVPDGYLSEDEGVQVDRMEIDLSAEDTKSSPSYKQELESKESCALVRQRKYLSSLTEQALQKNQPLIILNLMHEKVPLLMAEDLSGTSNMEQKCLQALSIRPFPGDLHVEITVDIMDDENEKDCLSNGKGSTTLISESDLPAIVSVIQSCSTNMNKILEALQQKFPSISRAQLRNKVREISDFNFAENRWQVKREILIELGYSPDKNGGRAKGIATFFSKRCLPPDGKSLNPNEASPLSSLKPGSAVHGQHGCTYNGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chromatin assembly factor 1 subunit FAS1	Component of the chromatin assembly factor complex (CAF-1) involved in chromatin assembly following DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. Required for several aspects of development, including seedling growth and leaf hair differentiation. Plays a critical role in the organization of shoot apical meristem (SAM) and root apical meristem (RAM) during postembryonic development by facilitating stable maintenance of gene expression states. Seems not required to maintain transcriptional repression of heterochromatic genes. Involved in heterologous recombination. May repress endocycle.	probable	Q9SXY0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 257-350
View the alignment between query and template
View the model in PyMOL

Template: 2YCU, chain A
Confidence level:probable
Coverage over the Query: 148-334
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 161-232
View the alignment between query and template
View the model in PyMOL