Citrus Sinensis ID: 003532
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 812 | 2.2.26 [Sep-21-2011] | |||||||
| Q96SB8 | 1091 | Structural maintenance of | yes | no | 0.908 | 0.676 | 0.276 | 3e-71 | |
| Q6P9I7 | 1128 | Structural maintenance of | N/A | no | 0.726 | 0.523 | 0.287 | 7e-70 | |
| Q924W5 | 1097 | Structural maintenance of | yes | no | 0.917 | 0.679 | 0.267 | 1e-68 | |
| Q802R8 | 1090 | Structural maintenance of | N/A | no | 0.868 | 0.646 | 0.264 | 3e-65 | |
| P53692 | 1140 | Structural maintenance of | yes | no | 0.683 | 0.486 | 0.286 | 6e-63 | |
| Q12749 | 1114 | Structural maintenance of | yes | no | 0.669 | 0.488 | 0.273 | 7e-63 | |
| Q54I56 | 1185 | Structural maintenance of | yes | no | 0.674 | 0.462 | 0.282 | 2e-58 | |
| O13710 | 1076 | Structural maintenance of | no | no | 0.168 | 0.127 | 0.32 | 9e-18 | |
| Q5ZJY5 | 1065 | Structural maintenance of | no | no | 0.176 | 0.134 | 0.348 | 1e-16 | |
| Q8IY18 | 1101 | Structural maintenance of | no | no | 0.171 | 0.126 | 0.304 | 1e-13 |
| >sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 270 bits (691), Expect = 3e-71, Method: Compositional matrix adjust.
Identities = 217/785 (27%), Positives = 398/785 (50%), Gaps = 47/785 (5%)
Query: 20 GTITRVRLENFMCHSSL-QIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAAT 78
G I + L+NFMCHS L + G VNF+ G NGSGKSA+LTAL + G RA T R ++
Sbjct: 46 GIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSS 105
Query: 79 LKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRVA 137
LK F+K G + A + + L+NRG+DAFK ++G+SI+I++ I+ + + + LK G V+
Sbjct: 106 LKGFVKDGQNSADISITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVVS 165
Query: 138 SRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQS 197
+RK+EL+ ++DHFNI V+NP +++Q+ S++FL S N+ DK+KFF KAT L+Q+ +
Sbjct: 166 TRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSY 225
Query: 198 IYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYD 257
I + + + E + +++ E + + +++ + + +L+ LK ++AW+ V +
Sbjct: 226 IMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVNE 285
Query: 258 VDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVR-- 315
+++QL I+ +DR R K++ + L +K +I +EK SE
Sbjct: 286 IEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAE----QKYKDIQDKLEKISEETNA 341
Query: 316 RRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLE-------QQVHDIQEQHV 368
R + + + K++ E E++ N S +N K L+ +++ ++++
Sbjct: 342 RAPECMALKADVVAKKRAYNEAEVLYNRS-----LNEYKALKKDDEQLCKRIEELKKSTD 396
Query: 369 RNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYD 428
++ + E E + K+ L+ + A + + +E + + K+K E +I E D
Sbjct: 397 QSLEPERLERQKKISWLKERVKAFQNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVK 456
Query: 429 KKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIE---RHHHKFKSPPIGPIGSHVTL 485
+ +++EL+ +T+++ FG + V +LL AI+ R H F P+GP+G+ + L
Sbjct: 457 HALSYNQRQLKELKDSKTDRLKRFGPN-VPALLEAIDDAYRQGH-FTYKPVGPLGACIHL 514
Query: 486 VNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCARE---ANYNHLQIIIYDFSRPRLS 542
+ + A A+E + LL A+ +H D +L+ + + II+ +F
Sbjct: 515 RDPE-LALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRPPIIVSEFRNEIYD 573
Query: 543 LPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRIS-NL 601
+ H H PT L+ L+ DN V N L+DM E +L+++ V +AV Q+ N
Sbjct: 574 VRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPPKNC 633
Query: 602 KEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAA-------LHVQEE 654
+E +T DG ++F+ G + + R L D +I DLE L++Q+
Sbjct: 634 REAFTADGDQVFA-GRYYS----SENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQH 688
Query: 655 AQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSAS 714
K + +EE L+ Q H + +K + R +S+ ++++ + D
Sbjct: 689 LSALEKDIKHNEELLKRCQLHYKELKMKI----RKNISEIRELENIEEHQSVDIATLEDE 744
Query: 715 AVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEA 774
A + S+ + ++E +++++ +E L+ EAE K + +K L E A D
Sbjct: 745 AQENKSK-MKMVEEHMEQQKENMEHLKSLKIEAENKYDAIKFKINQLSELADPLKDELNL 803
Query: 775 AEKEL 779
A+ E+
Sbjct: 804 ADSEV 808
|
Core component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies. Homo sapiens (taxid: 9606) |
| >sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 812 | ||||||
| 225454979 | 1057 | PREDICTED: structural maintenance of chr | 0.974 | 0.748 | 0.701 | 0.0 | |
| 255539813 | 1058 | structural maintenance of chromosomes 6 | 0.974 | 0.747 | 0.682 | 0.0 | |
| 297744975 | 1027 | unnamed protein product [Vitis vinifera] | 0.937 | 0.740 | 0.712 | 0.0 | |
| 224071509 | 1046 | predicted protein [Populus trichocarpa] | 0.956 | 0.742 | 0.675 | 0.0 | |
| 449458365 | 1052 | PREDICTED: structural maintenance of chr | 0.956 | 0.738 | 0.676 | 0.0 | |
| 449519372 | 969 | PREDICTED: LOW QUALITY PROTEIN: structur | 0.956 | 0.801 | 0.676 | 0.0 | |
| 15240258 | 1057 | protein MIM [Arabidopsis thaliana] gi|10 | 0.967 | 0.743 | 0.620 | 0.0 | |
| 297797105 | 1057 | hypothetical protein ARALYDRAFT_496305 [ | 0.967 | 0.743 | 0.623 | 0.0 | |
| 15240835 | 1058 | structural maintenance of chromosomes 6A | 0.949 | 0.728 | 0.596 | 0.0 | |
| 229620418 | 876 | truncated structural maintenance of chro | 0.949 | 0.880 | 0.595 | 0.0 |
| >gi|225454979|ref|XP_002278113.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1125 bits (2911), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 555/791 (70%), Positives = 669/791 (84%)
Query: 1 MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILT 60
MGD ++ RS AG I ++RLENFMCHSSLQIELGEW+NF+TGQNGSGKSAILT
Sbjct: 1 MGDSTVFTQPLSASHRSSAGIILKIRLENFMCHSSLQIELGEWLNFVTGQNGSGKSAILT 60
Query: 61 ALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRIT 120
ALC+AFG RAK TQRA TLK+FIKTGCSYA+++VE+KN GEDAFKPEI+GD II+ERRI+
Sbjct: 61 ALCVAFGSRAKETQRATTLKEFIKTGCSYAVIQVEIKNEGEDAFKPEIYGDVIIVERRIS 120
Query: 121 ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180
STS+TVLKDHQGKRVASRK++L EL++HFNIDVENPCVIMSQDKSREFLHSGNDKDKFK
Sbjct: 121 VSTSSTVLKDHQGKRVASRKEDLHELVEHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180
Query: 181 FFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEIT 240
FFFKATLLQQVNDLL +I L+ + LV ELE +I+P KEL+ELQ KIRNMEHVEEI+
Sbjct: 181 FFFKATLLQQVNDLLVNIGTRLDSANTLVEELEKSIEPILKELNELQVKIRNMEHVEEIS 240
Query: 241 QDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKK 300
Q +Q+LKKKLAWSWVYDVDRQL+EQ+ KIEKLKDRIP CQA+ID + +E LR+C KK
Sbjct: 241 QQVQQLKKKLAWSWVYDVDRQLQEQSAKIEKLKDRIPTCQARIDRQLGKMEELRECLTKK 300
Query: 301 KAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQV 360
K +IA M+EKT+EVRR K++LQQ +SLATKE+LELE E R T+ +QKMVN V+ L+QQV
Sbjct: 301 KTQIACMMEKTTEVRRMKEDLQQRLSLATKERLELEEEHCRKTNKIQKMVNLVRRLDQQV 360
Query: 361 HDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRI 420
H++ EQ ++NTQAEESEI+ LK LQ E+D N+ LSR+KEE+SALS LS + +EIR+I
Sbjct: 361 HEVHEQDLKNTQAEESEIKEMLKGLQDELDTTNLILSRLKEEESALSASLSIKMDEIRKI 420
Query: 421 SDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIG 480
SDEI+DY++K RE S I ELQQHQTNKVTAFGGDRVI LLRAIERHH +FK PPIGPIG
Sbjct: 421 SDEIDDYERKHRENYSYICELQQHQTNKVTAFGGDRVIQLLRAIERHHQRFKRPPIGPIG 480
Query: 481 SHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPR 540
+H+TLVNGD WA AVE AIG++LNAFIVTDHKD+LLLRGCAREANYNHLQIIIYDFSRPR
Sbjct: 481 AHLTLVNGDIWAIAVEIAIGKMLNAFIVTDHKDSLLLRGCAREANYNHLQIIIYDFSRPR 540
Query: 541 LSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISN 600
L++P+HMLP T+HPT +S L SDNPTV+NVLVDMG+AERQVLVRDY+VGK VAF+QRI N
Sbjct: 541 LNIPYHMLPQTQHPTLISALHSDNPTVMNVLVDMGNAERQVLVRDYEVGKTVAFDQRIPN 600
Query: 601 LKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRK 660
LKEVYT DG++MFSRGSVQTILP N++ RTGRLC S+D +IKDLER AL +QE Q+ ++
Sbjct: 601 LKEVYTSDGYRMFSRGSVQTILPPNKKARTGRLCSSFDSQIKDLERYALDIQEHGQEVKR 660
Query: 661 RKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEIS 720
+KR++EE LQDLQ Q++KRR +AER+ MSK+L QDVKNS+ A++ P AS+VDE+
Sbjct: 661 KKRNAEEELQDLQDKLQSIKRRRLNAERDVMSKKLRLQDVKNSYVAESNPAPASSVDELH 720
Query: 721 QEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELM 780
EIS +Q EI+EKEI+LE Q M++A+AK DLKLSF++LCESAK E+D +EAAE EL+
Sbjct: 721 HEISKVQAEIREKEILLEDFQLRMSKADAKANDLKLSFENLCESAKVEIDAYEAAENELV 780
Query: 781 EIEKNLQTSES 791
IE+ L ++E+
Sbjct: 781 VIEQELCSAET 791
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255539813|ref|XP_002510971.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] gi|223550086|gb|EEF51573.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297744975|emb|CBI38567.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224071509|ref|XP_002303494.1| predicted protein [Populus trichocarpa] gi|222840926|gb|EEE78473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449458365|ref|XP_004146918.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449519372|ref|XP_004166709.1| PREDICTED: LOW QUALITY PROTEIN: structural maintenance of chromosomes protein 6-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15240258|ref|NP_200954.1| protein MIM [Arabidopsis thaliana] gi|10177176|dbj|BAB10445.1| SMC-like protein [Arabidopsis thaliana] gi|332010088|gb|AED97471.1| protein MIM [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797105|ref|XP_002866437.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] gi|297312272|gb|EFH42696.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15240835|ref|NP_196383.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] gi|9759587|dbj|BAB11444.1| SMC-like protein [Arabidopsis thaliana] gi|332003807|gb|AED91190.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|229620418|gb|ACQ84165.1| truncated structural maintenance of chromosomes family protein 6A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 812 | ||||||
| TAIR|locus:2161163 | 1057 | MIM "AT5G61460" [Arabidopsis t | 0.966 | 0.742 | 0.590 | 5.5e-244 | |
| TAIR|locus:2160289 | 1058 | SMC6A "structural maintenance | 0.969 | 0.743 | 0.565 | 6e-238 | |
| ZFIN|ZDB-GENE-070705-287 | 1090 | si:dkey-119f1.1 "si:dkey-119f1 | 0.837 | 0.623 | 0.295 | 7.1e-77 | |
| UNIPROTKB|E2QUA0 | 1097 | SMC6 "Uncharacterized protein" | 0.800 | 0.592 | 0.280 | 3.7e-76 | |
| UNIPROTKB|E1BFH7 | 1101 | SMC6 "Uncharacterized protein" | 0.917 | 0.676 | 0.267 | 5.5e-74 | |
| UNIPROTKB|F1SCS4 | 1098 | SMC6 "Uncharacterized protein" | 0.916 | 0.677 | 0.265 | 1.5e-73 | |
| UNIPROTKB|Q96SB8 | 1091 | SMC6 "Structural maintenance o | 0.915 | 0.681 | 0.265 | 1.9e-73 | |
| RGD|1311214 | 1097 | Smc6 "structural maintenance o | 0.929 | 0.688 | 0.259 | 6.2e-73 | |
| MGI|MGI:1914491 | 1097 | Smc6 "structural maintenance o | 0.929 | 0.688 | 0.259 | 1.8e-72 | |
| CGD|CAL0003255 | 1128 | SMC6 [Candida albicans (taxid: | 0.944 | 0.679 | 0.257 | 3.4e-71 |
| TAIR|locus:2161163 MIM "AT5G61460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2351 (832.7 bits), Expect = 5.5e-244, P = 5.5e-244
Identities = 465/788 (59%), Positives = 590/788 (74%)
Query: 15 QRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQ 74
QRSG+G+I R+++ENFMCHS+LQIE GEWVNFITGQNGSGKSAILTALC+AFGCRA+GTQ
Sbjct: 15 QRSGSGSILRIKVENFMCHSNLQIEFGEWVNFITGQNGSGKSAILTALCVAFGCRARGTQ 74
Query: 75 RAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGK 134
RAATLKDFIKTGCSYA+V+VE+KN GEDAFKPEI+G IIIERRITES + TVLKD+ GK
Sbjct: 75 RAATLKDFIKTGCSYAVVQVEMKNSGEDAFKPEIYGGVIIIERRITESATATVLKDYLGK 134
Query: 135 RVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNXXXXXXXXXXATLLQQVNDL 194
+V++++ EL EL++HFNIDVENPCV+MSQDKSREFLHSGN ATLLQQVNDL
Sbjct: 135 KVSNKRDELRELVEHFNIDVENPCVVMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDL 194
Query: 195 LQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSW 254
LQSIY HL K A+V ELE TIKP EKE+SEL+ KI+NME VEEI Q LQ+LKKKLAWSW
Sbjct: 195 LQSIYEHLTKATAIVDELENTIKPIEKEISELRGKIKNMEQVEEIAQRLQQLKKKLAWSW 254
Query: 255 VYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEV 314
VYDVDRQL+EQT KI KLK+RIP CQAKID +ESLRD KKKA++A ++++++ +
Sbjct: 255 VYDVDRQLQEQTEKIVKLKERIPTCQAKIDWELGKVESLRDTLTKKKAQVACLMDESTAM 314
Query: 315 RRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAE 374
+R + QS A +EK+ L+ E +Y+QK+ +RV+ LE+QV DI EQ ++NTQAE
Sbjct: 315 KREIESFHQSAKTAVREKIALQEEFNHKCNYVQKIKDRVRRLERQVGDINEQTMKNTQAE 374
Query: 375 ESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREI 434
+SEIE KLK L+ E++ SR+KEE++ EK + + ++ I D I+++ K+ R I
Sbjct: 375 QSEIEEKLKYLEQEVEKVETLRSRLKEEENCFLEKAFEGRKKMEHIEDMIKNHQKRQRFI 434
Query: 435 RSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPA 494
S I +L++HQTNKVTAFGGDRVI+LL+AIER+H +F+ PPIGPIGSHVTLVNG+ WA +
Sbjct: 435 TSNINDLKKHQTNKVTAFGGDRVINLLQAIERNHRRFRKPPIGPIGSHVTLVNGNKWASS 494
Query: 495 VEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHP 554
VEQA+G LLNAFIVTDHKD+L LRGCA EANY +L+IIIYDFSRPRL++P HM+P T+HP
Sbjct: 495 VEQALGTLLNAFIVTDHKDSLTLRGCANEANYRNLKIIIYDFSRPRLNIPRHMVPQTEHP 554
Query: 555 TTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFS 614
T SV+ SDNPTV+NVLVD ERQVL +Y+ GKAVAF +R+SNLKEVYTLDG+KMF
Sbjct: 555 TIFSVIDSDNPTVLNVLVDQSGVERQVLAENYEEGKAVAFGKRLSNLKEVYTLDGYKMFF 614
Query: 615 RGSVQTILP-LNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQ 673
RG VQT LP L+RR RLC S+D++IKDLE A Q E QC +RKR++EE L++L+
Sbjct: 615 RGPVQTTLPPLSRR--PSRLCASFDDQIKDLEIEASKEQNEINQCMRRKREAEENLEELE 672
Query: 674 QHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDXXXXXXXXXXXXXXXX 733
+ +K+ AE+ +KEL D+KN+ AA+ +S+V+
Sbjct: 673 LKVRQLKKHRSQAEKVLTTKELEMHDLKNTVAAEIEALPSSSVNELQREIMKDLEEIDEK 732
Query: 734 XXXXXXXXFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESVS 793
+ EAE K L F+++ ESAK E+D FE AE EL +IEK+LQ++E+
Sbjct: 733 EAFLEKLQNCLKEAELKANKLTALFENMRESAKGEIDAFEEAENELKKIEKDLQSAEAEK 792
Query: 794 YSFLNFFQ 801
+ N +
Sbjct: 793 IHYENIMK 800
|
|
| TAIR|locus:2160289 SMC6A "structural maintenance of chromosomes 6A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-287 si:dkey-119f1.1 "si:dkey-119f1.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUA0 SMC6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BFH7 SMC6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCS4 SMC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96SB8 SMC6 "Structural maintenance of chromosomes protein 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1311214 Smc6 "structural maintenance of chromosomes 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914491 Smc6 "structural maintenance of chromosomes 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003255 SMC6 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | estExt_fgenesh4_pm.C_LG_III0304 | hypothetical protein (1046 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 812 | |||
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 3e-47 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-30 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-21 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-19 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 3e-19 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-16 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-15 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-14 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 4e-13 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 4e-13 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 1e-12 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-11 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 4e-10 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 1e-09 | |
| cd03241 | 276 | cd03241, ABC_RecN, ATP-binding cassette domain of | 3e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 9e-08 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 1e-07 | |
| COG1195 | 363 | COG1195, RecF, Recombinational DNA repair ATPase ( | 1e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-07 | |
| PRK00064 | 361 | PRK00064, recF, recombination protein F; Reviewed | 5e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| TIGR00611 | 365 | TIGR00611, recf, recF protein | 7e-06 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 8e-06 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 1e-05 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| PTZ00491 | 850 | PTZ00491, PTZ00491, major vault protein; Provision | 3e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| pfam01496 | 707 | pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni | 4e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-05 | |
| cd03242 | 270 | cd03242, ABC_RecF, ATP-binding cassette domain of | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| cd03279 | 213 | cd03279, ABC_sbcCD, ATP-binding cassette domain of | 2e-04 | |
| COG3593 | 581 | COG3593, COG3593, Predicted ATP-dependent endonucl | 6e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 6e-04 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 7e-04 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 8e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.001 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 0.001 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.001 | |
| COG1106 | 371 | COG1106, COG1106, Predicted ATPases [General funct | 0.001 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 0.001 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.002 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.003 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.004 |
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
Score = 166 bits (422), Expect = 3e-47
Identities = 58/155 (37%), Positives = 68/155 (43%), Gaps = 52/155 (33%)
Query: 22 ITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKD 81
I + L+NFMCH LQIE G VNFI G NGSGKSAILTAL I G +A T R ++LKD
Sbjct: 1 IESITLKNFMCHRHLQIEFGPRVNFIVGNNGSGKSAILTALTIGLGGKASDTNRGSSLKD 60
Query: 82 FIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQ 141
IK G S A + V LKN+G DA
Sbjct: 61 LIKDGESSAKITVTLKNQGLDA-------------------------------------- 82
Query: 142 ELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDK 176
NP ++SQD +R FL S
Sbjct: 83 --------------NPLCVLSQDMARSFLTSNKAA 103
|
The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18). Length = 198 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213208 cd03241, ABC_RecN, ATP-binding cassette domain of RecN | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|224116 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234608 PRK00064, recF, recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233051 TIGR00611, recf, recF protein | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|240439 PTZ00491, PTZ00491, major vault protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213209 cd03242, ABC_RecF, ATP-binding cassette domain of RecF | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD | Back alignment and domain information |
|---|
| >gnl|CDD|226121 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|224031 COG1106, COG1106, Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 812 | |||
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 99.97 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.97 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.97 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.96 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 99.95 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 99.94 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.93 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.92 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.92 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.9 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 99.87 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 99.86 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.86 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.85 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.82 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.81 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.81 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.8 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.79 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.77 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.77 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.75 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.74 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.74 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.73 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.72 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.71 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.7 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 99.7 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.67 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.66 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.65 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.64 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.63 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.63 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 99.61 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.61 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.6 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.52 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.52 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.51 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.49 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.45 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 99.37 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.35 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.33 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.31 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.31 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.26 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 99.14 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.07 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 99.06 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.03 | |
| PF11398 | 373 | DUF2813: Protein of unknown function (DUF2813); In | 98.95 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.89 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.87 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.84 | |
| PF04310 | 227 | MukB: MukB N-terminal; InterPro: IPR007406 This is | 98.83 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.82 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.82 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.69 | |
| COG3593 | 581 | Predicted ATP-dependent endonuclease of the OLD fa | 98.65 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.65 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.61 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 98.55 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.52 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.47 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.42 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.37 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 98.35 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.35 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.32 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.27 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.25 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.24 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.22 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.21 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.21 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.21 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.21 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.19 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.16 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 98.14 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.14 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.12 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.11 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.08 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.07 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.05 | |
| COG4938 | 374 | Uncharacterized conserved protein [Function unknow | 98.03 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.02 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.02 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 98.01 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 98.01 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.99 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.97 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.97 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.96 | |
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 97.96 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.94 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.94 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 97.94 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.93 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.92 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.91 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.91 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.9 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.9 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.9 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.9 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.89 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.89 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 97.89 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.89 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.88 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 97.86 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.86 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.86 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.85 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.85 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.85 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.84 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.84 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.84 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.83 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 97.83 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.83 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.83 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.82 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 97.82 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.81 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 97.81 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 97.81 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.8 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 97.8 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.8 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 97.8 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 97.8 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.8 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.8 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 97.79 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.79 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.79 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.78 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.78 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.78 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.78 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.78 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.78 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 97.78 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.77 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.77 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.77 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.77 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.77 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.77 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.77 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 97.77 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 97.77 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 97.76 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.76 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.76 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.75 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.75 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 97.75 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 97.75 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.75 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.75 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 97.75 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 97.75 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.75 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 97.75 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.75 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 97.75 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.74 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.74 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 97.74 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.74 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.74 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.74 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.74 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.73 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.73 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.73 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 97.73 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 97.73 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 97.73 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.73 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 97.73 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.73 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 97.73 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.72 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 97.72 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 97.72 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.72 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 97.72 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.72 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.71 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 97.71 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 97.71 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 97.71 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 97.7 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.7 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.7 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 97.69 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 97.69 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.69 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.69 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.69 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 97.69 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 97.69 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 97.69 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.69 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 97.69 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 97.68 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.68 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.68 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.68 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.68 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.68 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 97.68 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.67 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 97.67 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 97.67 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.67 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.67 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 97.67 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 97.67 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.67 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.67 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 97.67 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.67 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.66 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 97.66 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 97.66 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.66 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.66 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 97.66 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 97.65 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 97.65 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.65 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.65 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.64 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 97.64 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 97.64 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.64 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.64 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.64 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 97.64 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.63 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 97.63 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.63 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.63 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.63 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.63 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.63 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.63 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.62 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.61 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 97.61 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 97.61 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.6 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 97.6 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.6 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.6 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 97.6 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.6 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 97.59 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 97.59 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.59 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 97.59 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.59 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 97.59 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.58 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.58 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 97.58 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.57 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.57 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.57 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.57 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.56 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 97.56 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.56 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.55 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.55 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 97.55 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 97.55 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.54 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.54 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.54 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.54 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.53 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 97.53 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.53 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 97.53 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.53 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.52 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.52 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 97.52 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.52 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.51 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.51 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 97.51 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 97.51 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 97.51 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 97.5 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.5 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 97.5 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 97.5 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 97.5 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 97.5 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 97.5 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 97.49 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 97.49 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 97.49 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 97.48 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 97.48 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 97.48 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 97.48 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 97.48 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.48 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.48 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 97.48 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.47 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 97.47 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.47 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 97.47 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 97.46 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.46 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 97.46 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.46 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 97.46 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 97.45 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 97.45 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.45 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 97.45 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 97.44 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.43 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.42 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.42 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.42 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 97.42 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 97.41 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 97.4 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.4 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.4 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 97.39 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 97.38 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 97.37 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.37 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.37 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.36 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 97.36 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.36 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 97.35 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 97.34 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 97.34 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.34 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.33 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 97.3 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.29 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.27 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.26 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.26 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 97.25 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 97.25 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.24 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.24 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 97.23 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 97.23 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 97.23 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 97.22 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.22 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.22 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.22 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.22 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 97.21 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.2 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 97.2 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.19 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.18 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 97.16 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.16 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 97.15 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 97.15 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 97.14 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 97.14 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.14 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 97.13 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 97.13 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 97.13 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 97.12 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.1 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.1 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.1 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.1 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.09 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.08 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.08 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.08 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.08 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 97.07 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.05 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 97.05 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 97.02 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.01 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 96.98 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 96.97 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 96.95 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.94 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 96.92 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 96.92 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.91 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 96.91 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 96.9 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 96.89 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.89 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.88 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 96.87 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.87 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 96.86 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.86 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 96.86 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 96.85 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.85 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 96.84 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.82 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.81 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 96.8 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 96.78 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.78 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 96.78 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.77 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.77 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 96.74 | |
| PF09818 | 448 | ABC_ATPase: Predicted ATPase of the ABC class; Int | 96.73 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 96.73 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 96.71 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 96.71 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.68 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 96.66 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 96.66 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.66 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.62 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 96.59 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.59 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 96.58 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 96.56 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.56 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 96.55 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 96.55 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.55 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 96.55 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.54 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 96.52 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 96.49 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.49 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 96.48 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.46 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 96.46 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 96.44 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.43 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 96.42 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.42 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.4 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 96.4 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.38 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 96.37 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 96.37 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 96.37 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 96.36 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.36 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.35 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 96.35 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 96.32 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 96.31 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 96.31 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 96.3 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 96.29 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 96.28 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 96.28 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 96.27 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 96.26 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 96.26 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.26 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.26 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.25 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 96.25 |
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-63 Score=521.73 Aligned_cols=764 Identities=36% Similarity=0.569 Sum_probs=634.0
Q ss_pred CCCCeeEeEEEEeecccccceEEEeCCceEEEEcCCCCChhHHHHHHHHHhcCCcCCcccccchhhhhhcCCceeEEEEE
Q 003532 16 RSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVE 95 (812)
Q Consensus 16 ~~~~m~i~~i~i~nf~~~~~~~i~f~~g~~~I~G~NgsGKStl~dai~~~l~~~~~~~~r~~~~~~~i~~~~~~~~v~l~ 95 (812)
+.-.++|.+|++.||+.+....|+|+|.+|.|+|+||||||.||-||..||||+++.+.||.++.++|+.|+.+|.|.++
T Consensus 36 ~~~sG~I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsIt 115 (1074)
T KOG0250|consen 36 RAESGKIESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISIT 115 (1074)
T ss_pred hhhcceEEEEEEeeecccccceeccCCCceEeecCCCCcHHHHHHHHHHhhccccccccchhhHHHHHhCCCcceEEEEE
Confidence 34469999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEeCCCCCCCccccCCeEEEEEEEeCCcCeEEEe-cCCCceeeccHHHHHHHHhhcCCCCCCCeeEeccchhhhhhcCCC
Q 003532 96 LKNRGEDAFKPEIFGDSIIIERRITESTSTTVLK-DHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGN 174 (812)
Q Consensus 96 ~~~~~~~~~~~~~~~~~~~i~r~~~~~~~~~~~~-~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~ 174 (812)
++|.|.++|.+.+||+.++|.|+|....+.|++. +..|++|+....+++.++..|++++.||++|+.|+..+.||....
T Consensus 116 L~N~G~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~I~veNP~~~lsQD~aR~FL~~~~ 195 (1074)
T KOG0250|consen 116 LSNSGLDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFNIQVENPMFVLSQDAARSFLANSN 195 (1074)
T ss_pred EecCCcccCChhhcCCeeEEEEeeccccchHHHHhhccCccccccHHHHHHHHHHhCcCCCCcchhhcHHHHHHHHhcCC
Confidence 9999999999999999999999999555555555 789999999999999999999999999999999999999999999
Q ss_pred chhHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHh
Q 003532 175 DKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSW 254 (812)
Q Consensus 175 ~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 254 (812)
|...|++|..++.++++...+..+.+.+....+.+......+..+++++++.+..+..++....+...+..+.....|..
T Consensus 196 p~dkYklfmkaT~L~qi~~~~~~~~~~~~~~~~~i~~~~e~i~~l~k~i~e~~e~~~~~~~~e~~~~~l~~Lk~k~~W~~ 275 (1074)
T KOG0250|consen 196 PKDKYKLFMKATQLEQITESYSEIMESLDHAKELIDLKEEEIKNLKKKIKEEEEKLDNLEQLEDLKENLEQLKAKMAWAW 275 (1074)
T ss_pred hHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHH
Q 003532 255 VYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLE 334 (812)
Q Consensus 255 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~ 334 (812)
+.....++......+...+..+..+.+.++.....+..+...+...++.+..+..+......++..+...+..+..+...
T Consensus 276 V~~~~~ql~~~~~~i~~~qek~~~l~~ki~~~~~k~~~~r~k~teiea~i~~~~~e~~~~d~Ei~~~r~~~~~~~re~~~ 355 (1074)
T KOG0250|consen 276 VNEVERQLNNQEEEIKKKQEKVDTLQEKIEEKQGKIEEARQKLTEIEAKIGELKDEVDAQDEEIEEARKDLDDLRREVND 355 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999888888888888888888888888888877778888888888888888888
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 003532 335 LEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEK 414 (812)
Q Consensus 335 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~ 414 (812)
+..++....+.+......+..++..+..+..+.......++.+.+.++..|..++..++..+..|..+.+.+........
T Consensus 356 ~~~~~~~~~n~i~~~k~~~d~l~k~I~~~~~~~~~~~~~~~~e~e~k~~~L~~evek~e~~~~~L~~e~~~~~~~~~~~~ 435 (1074)
T KOG0250|consen 356 LKEEIREIENSIRKLKKEVDRLEKQIADLEKQTNNELGSELEERENKLEQLKKEVEKLEEQINSLREELNEVKEKAKEEE 435 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 88888888888888888888888888888877766677777888888888888888888888888888888888888888
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCccccCCcccHHHHHHHHHhhcCCCcCCCcccccccEEecCCCccHHH
Q 003532 415 NEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPA 494 (812)
Q Consensus 415 ~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a 494 (812)
.+...++..+..+...+......+..+.....+.+..|| +.+..++..+...+..|..+|.||++.+|++.+ +.|..+
T Consensus 436 ee~~~i~~~i~~l~k~i~~~~~~l~~lk~~k~dkvs~FG-~~m~~lL~~I~r~~~~f~~~P~GPlG~~Vtl~~-~KWa~a 513 (1074)
T KOG0250|consen 436 EEKEHIEGEILQLRKKIENISEELKDLKKTKTDKVSAFG-PNMPQLLRAIERRKRRFQTPPKGPLGKYVTLKE-PKWALA 513 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhcc-hhhHHHHHHHHHHHhcCCCCCCCCccceeEecC-cHHHHH
Confidence 888888888999999999999999999988888899999 999999999999888888899999999999998 899999
Q ss_pred HHHHHhcccceeeecChhhHHHHHHHHHHhCcCCcceEEEecCCCCCCCCCCCCCCCCCccchhccccCchhHHHHhhcc
Q 003532 495 VEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDM 574 (812)
Q Consensus 495 ~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~ 574 (812)
|+.++|+.+.+|+|.+..++..+..+++..+++..++..+.+..+...++....|+-.++.+++.+.++++.+...+++.
T Consensus 514 IE~~L~n~lnaFiv~sh~D~~~Lr~i~~~~~~~~~~ptIvvs~~~~~~y~~~~~p~~~~pTil~~le~ddp~V~N~LID~ 593 (1074)
T KOG0250|consen 514 IERCLGNLLNAFIVTSHKDARILRAIMRRLKIPGNRPTIVVSSFTPFDYSVGRNPGYEFPTILDALEFDDPEVLNVLIDK 593 (1074)
T ss_pred HHHHHHHhhhhheeCCHhhHHHHHHHHHHcCCCCCCCcEEEecCCccccccccCCCCCCCceeeeeecCChHHHHHhhhh
Confidence 99999999999999999999999999998887643333344444444555555555557888999999999999999999
Q ss_pred CccceEEEeCChHHHHHHhhhc-CCCCcceEEcccCceeeecCC---cccccccccccCCccccCCHHHHHHHHHHHHHH
Q 003532 575 GSAERQVLVRDYDVGKAVAFEQ-RISNLKEVYTLDGHKMFSRGS---VQTILPLNRRLRTGRLCGSYDEKIKDLERAALH 650 (812)
Q Consensus 575 ~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~i~~ 650 (812)
..+...++..+...+..+.... .+.+...++|.+|..+...|. .....+...+ ++..........+.+|+.++..
T Consensus 594 s~iE~~lLiEdk~Ea~~~m~s~~~p~n~~~aytldg~~~~~~g~~~~~ySt~~~~~r-~~~~~~~s~d~~ie~le~e~~~ 672 (1074)
T KOG0250|consen 594 SGIEQVLLIEDKKEAREFMQSDKPPANVTKAYTLDGRQIFAGGPNYRVYSTRGTRAR-RPGVDEFSFDDEIEDLEREASR 672 (1074)
T ss_pred ccceeEEEecchHHHHHHHhcCCCCccceeeeccCccccccCCCCcceeccCCCCCC-CccccchhHhHHHHHHHHHHHH
Confidence 9999999999866666665433 244666788999988877766 1111111111 3345556688889999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh--hhccCCCCCccchhHHHHHHHHHHH
Q 003532 651 VQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNS--FAADAGPPSASAVDEISQEISNIQE 728 (812)
Q Consensus 651 l~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~--~~~~~~~~~~~~~~~l~~~~~~l~~ 728 (812)
++.++..++......+..+..++..+..+...+.+++..+.....++..++.. .... -...++.+..++.....
T Consensus 673 l~~~~~~l~~~~~~~e~~l~e~~~~~~~l~~~~~q~~~~~~~~~~em~el~n~~e~~~~----~~~~~~~l~~ei~~~~~ 748 (1074)
T KOG0250|consen 673 LQKEILELENQRREAEKNLEELEKKLRELSEHIEQIKRRIRKKRAEMTELKNTAEEKQV----DISKLEDLAREIKKKEK 748 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhc----chhhhHHHHHHHHHHHH
Confidence 99988888888888888888888888888888888888888888888877773 2221 12234455555555555
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 003532 729 EIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNL 786 (812)
Q Consensus 729 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~ 786 (812)
+++.....+..+.+.+..+..+...+...++.....+......+..+..++.....++
T Consensus 749 eIe~~~~~~e~l~~e~e~~~~e~~e~~~~~~~~~~~l~~e~~~l~~l~~el~~r~dk~ 806 (1074)
T KOG0250|consen 749 EIEEKEAPLEKLKEELEHIELEAQELEEYYAAGREKLQGEISKLDALKEELKLREDKL 806 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHH
Confidence 5555555555555555555555555555555555555444444444444444333333
|
|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PF04310 MukB: MukB N-terminal; InterPro: IPR007406 This is the N-terminal region of MukB | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4938 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 812 | ||||
| 1ii8_A | 195 | Crystal Structure Of The P. Furiosus Rad50 Atpase D | 2e-05 | ||
| 3qku_A | 359 | Mre11 Rad50 Binding Domain In Complex With Rad50 An | 2e-05 | ||
| 3qkt_A | 339 | Rad50 Abc-Atpase With Adjacent Coiled-Coil Region I | 2e-05 | ||
| 3qkr_A | 203 | Mre11 Rad50 Binding Domain Bound To Rad50 Length = | 2e-05 | ||
| 1us8_A | 147 | The Rad50 Signature Motif: Essential To Atp Binding | 9e-05 | ||
| 1f2t_A | 149 | Crystal Structure Of Atp-free Rad50 Abc-atpase Leng | 1e-04 |
| >pdb|1II8|A Chain A, Crystal Structure Of The P. Furiosus Rad50 Atpase Domain Length = 195 | Back alignment and structure |
|
| >pdb|3QKU|A Chain A, Mre11 Rad50 Binding Domain In Complex With Rad50 And Amp-Pnp Length = 359 | Back alignment and structure |
| >pdb|3QKT|A Chain A, Rad50 Abc-Atpase With Adjacent Coiled-Coil Region In Complex With Amp- Pnp Length = 339 | Back alignment and structure |
| >pdb|3QKR|A Chain A, Mre11 Rad50 Binding Domain Bound To Rad50 Length = 203 | Back alignment and structure |
| >pdb|1US8|A Chain A, The Rad50 Signature Motif: Essential To Atp Binding And Biological Function Length = 147 | Back alignment and structure |
| >pdb|1F2T|A Chain A, Crystal Structure Of Atp-free Rad50 Abc-atpase Length = 149 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
Score = 90.3 bits (224), Expect = 2e-19
Identities = 50/282 (17%), Positives = 109/282 (38%), Gaps = 22/282 (7%)
Query: 22 ITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKD 81
+ +R+ NF H + +I+ + + I G+NGSGKS+I A+ A G
Sbjct: 5 LKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALF----GAGSNFNYDT 60
Query: 82 FIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQ 141
I G VE++ + G + I R L GK A+
Sbjct: 61 IITKGKKSVYVELDFEVNGNN----------YKIIREYDSGRGGAKLYK-NGKPYATTIS 109
Query: 142 ELLELI-DHFNIDVENP--CVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSI 198
+ + + + +D + + Q + +FL +K + K + + Q +
Sbjct: 110 AVNKAVNEILGVDRNMFLNSIYIKQGEIAKFLSL-KPSEKLETVAKLLGIDEFEKCYQKM 168
Query: 199 YNHLNKGDALVLELEATIKPTEKELSELQRKIRNME-HVEEITQDLQRLKKKLAWSWVYD 257
+ + + + +E + E+ L +++ N+E E++T+ ++ L K
Sbjct: 169 GEIVKEYEKRLERIEGELNYKEESLKARLKEMSNLEKEKEKLTKFVEYLDKVRRIFGRNG 228
Query: 258 VDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMK 299
L+E+ + ++ + ++ D +S +E +D ++
Sbjct: 229 FQAYLREKYV--PLIQKYLNEAFSEFDLPYSFVELTKDFEVR 268
|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Length = 227 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Length = 483 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 812 | ||||
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 7e-19 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 1e-15 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 4e-14 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 1e-13 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 9e-13 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 9e-09 | |
| d1gxja_ | 161 | d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti | 7e-06 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 87.9 bits (216), Expect = 7e-19
Identities = 34/175 (19%), Positives = 64/175 (36%), Gaps = 16/175 (9%)
Query: 20 GTITRVRLENFMCHSSLQ-IELGEW-VNFITGQNGSGKSAILTALCIAFGCRAKGTQRAA 77
G + + L NF + + + GE I G NGSGKS ++ A+ G R+ R+
Sbjct: 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHL-RSN 59
Query: 78 TLKDFIKTGCSYAMVEVELKNRGEDAFKP---------EIFGDSIIIERRITESTSTTVL 128
LKD I G + N G + P + + + R I+ + T+
Sbjct: 60 ILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYK 119
Query: 129 KDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFF 183
D + ++ +++ NI ++ ++ Q + + F
Sbjct: 120 IDGK----TVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEE 170
|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 812 | |||
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.91 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.82 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.78 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.77 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.66 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 99.47 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 98.06 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.63 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.48 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.48 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.47 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.47 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.41 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.41 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.37 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.33 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.31 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.3 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.23 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.22 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.17 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.13 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.12 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.03 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.92 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.8 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.62 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.32 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.28 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.81 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.09 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.06 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.93 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.66 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.48 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.84 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.8 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.69 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.58 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.42 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.38 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.35 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.32 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.26 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 93.2 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.1 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 92.98 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.96 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.95 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.8 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 92.78 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.71 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 92.66 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 92.47 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.43 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 92.42 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 92.22 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 92.09 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 91.84 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 91.83 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 91.76 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 91.74 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 91.73 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 91.71 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.57 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 91.44 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.39 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 91.37 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 91.18 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.15 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.12 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 90.91 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.85 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 90.8 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 90.79 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 90.74 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 90.69 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 90.58 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 90.58 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 90.46 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 90.45 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 90.19 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.11 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.06 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 89.98 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 89.95 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 89.81 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 89.71 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 89.61 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 89.54 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.35 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 89.13 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 89.03 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 88.99 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.92 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 88.87 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 88.82 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 88.77 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 88.63 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 88.48 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 88.2 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 88.17 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 88.15 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 88.13 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 87.98 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 87.83 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.76 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 87.71 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 87.54 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 87.52 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 87.33 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 87.29 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 87.29 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 87.26 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.12 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 87.03 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 86.96 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 86.91 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 86.89 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 86.83 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 86.78 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.77 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 86.69 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.65 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 86.58 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.52 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 86.37 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.29 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 86.2 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 86.18 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 86.16 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 86.07 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 86.05 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 86.03 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 85.98 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 85.94 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 85.83 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 85.73 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 85.29 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.27 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 85.15 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 85.09 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 85.02 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 84.93 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 84.75 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 84.7 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 84.61 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.49 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 84.48 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 84.38 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 84.3 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 84.17 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 84.07 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 83.96 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 83.91 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 83.7 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 83.59 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 83.14 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 82.93 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 82.84 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 82.57 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 82.26 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 82.18 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.11 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 82.05 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 82.03 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 82.03 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 81.98 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 81.8 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 81.76 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 81.56 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 81.45 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 81.25 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 81.22 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 80.84 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 80.81 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 80.71 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 80.69 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 80.55 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 80.5 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 80.38 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 80.33 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 80.28 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91 E-value=2.4e-23 Score=179.59 Aligned_cols=147 Identities=22% Similarity=0.315 Sum_probs=117.4
Q ss_pred EEEEEEEEEECCCCC-CEEEEEC-CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEE
Q ss_conf 047489985113312-1488827-95589982899994689999999815876776652001243432973049999997
Q 003532 20 GTITRVRLENFMCHS-SLQIELG-EWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELK 97 (812)
Q Consensus 20 m~i~~i~i~nf~~~~-~~~i~f~-~g~~~I~G~NgsGKSti~dai~~~l~~~~~~~~r~~~~~~~i~~~~~~~~v~l~~~ 97 (812)
++|++|.|.||++|. .++|+|+ +|+|+|+||||||||||++||.||||+.++. .|+..+.++|+.|...+.+...|.
T Consensus 1 ~ki~~l~l~NFks~~~~~~i~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~-~R~~~~~dli~~g~~~~~~~~~~~ 79 (427)
T d1w1wa_ 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNH-LRSNILKDLIYRGVLNDENSDDYD 79 (427)
T ss_dssp CCEEEEEEESCSSCCSEEEEECTTCSEEEEECSTTSSHHHHHHHHHHHTTC----------CGGGSCCC-----------
T ss_pred CEEEEEEEECEEEECCCEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCHHHEECCCCCCCCEEEEE
T ss_conf 9288999949441079879758999989999999998899999999985778510-023340665246876775128987
Q ss_pred ECCCCCC---------CCCCCCCEEEEEEEEE-CCCCEEEEECCCCCEEECCHHHHHHHHHHCCCCCCCCEEEECCCHHH
Q ss_conf 0797777---------7554699289998871-89674899648994531338899999866388878993573310045
Q 003532 98 NRGEDAF---------KPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSR 167 (812)
Q Consensus 98 ~~~~~~~---------~~~~~~~~~~i~R~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~ 167 (812)
..+.... .....+..+.+.|.+. .+.+.|++ +|+.+ +..++..++..+++...++++++.|+.+.
T Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~~i~i~r~i~~~~~~~~~i---n~~~~--~~~~i~~~~~~~~~~~~~~~~~i~q~~~~ 154 (427)
T d1w1wa_ 80 NEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKI---DGKTV--SYKDYSIFLENENILIKAKNFLVFQGDVE 154 (427)
T ss_dssp --------CCEEEEEEEEEETTEEEEEEEEEETTSCEEEEE---TTEEE--CHHHHHHHHHHTTCCTTTCTTEECTTCTT
T ss_pred EECCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCEEEEC---CCCCC--CHHHHHHHHHHCCCCCCCCCCEECHHHHH
T ss_conf 41233444200011245305892799999972589636702---76444--29999999987087878865242204566
Q ss_pred HHHCC
Q ss_conf 42107
Q 003532 168 EFLHS 172 (812)
Q Consensus 168 ~~l~~ 172 (812)
.++..
T Consensus 155 ~~~~~ 159 (427)
T d1w1wa_ 155 QIAAQ 159 (427)
T ss_dssp HHHHS
T ss_pred HHHHC
T ss_conf 66640
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|