Citrus Sinensis ID: 003606

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------81
MSRPFMSIQLRERILFRVLQLIVVVNVIAFSNSKPVLNKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYEWWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFGFREKRVLKGFGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTFQPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFEYQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRLGLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAIIGPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAKKADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSFAEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRADSSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTGSRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVPKVSQGTPEKQLIGFDRVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHVLMVGELRHSLTIETY
ccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHHccccEEEEccHHHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcEEEEEccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHcccccCEECcccccccccccHHHHHHHHHHHHccEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccccccHccccccEEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccEEEEEEECcccccccccccccccCEEEEEccccEEEEEEEECcccccEEEcccccEEEccCEEEEEEcccccCEEEECc
******SIQLRERILFRVLQLIVVVNVIAFSNSKPVLNKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYEWWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFGFREKRVLKGFGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTFQPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFEYQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRLGLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAIIGPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAKKADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSFAEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRAD****YPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTI**SLKAGSDKNILQQTGSRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVPKVSQGTPEKQLIGFDRVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHVLMVGELRHSL*IETY
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRPFMSIQLRERILFRVLQLIVVVNVIAFSNSKPVLNKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYEWWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFGFREKRVLKGFGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTFQPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFEYQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRLGLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAIIGPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAKKADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSFAEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRADSSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTGSRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVPKVSQGTPEKQLIGFDRVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHVLMVGELRHSLTIETY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable beta-D-xylosidase 6 probableQ9LXA8
Exo-1,4-beta-xylosidase bxlB Xylan 1,4-beta-xylosidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Active against rye arabinoxylan and xylohexaose, but not paranitrophenyl-beta-xyloside.probableQ5ATH9
Probable exo-1,4-beta-xylosidase bxlB Xylan 1,4-beta-xylosidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose.probableQ4WFI6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.37Xylan 1,4-beta-xylosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ABZ, chain A
Confidence level:very confident
Coverage over the Query: 63-215,241-330,345-538
View the alignment between query and template
View the model in PyMOL
Template: 3ABZ, chain A
Confidence level:very confident
Coverage over the Query: 63-215,241-330,345-538
View the alignment between query and template
View the model in PyMOL
Template: 2X41, chain A
Confidence level:confident
Coverage over the Query: 64-215,241-330,343-681,703-806
View the alignment between query and template
View the model in PyMOL
Template: 3RRX, chain A
Confidence level:confident
Coverage over the Query: 51-105,116-206,228-641,656-678
View the alignment between query and template
View the model in PyMOL
Template: 1X38, chain A
Confidence level:confident
Coverage over the Query: 56-105,116-224,241-496,508-641,656-663
View the alignment between query and template
View the model in PyMOL
Template: 4I8D, chain A
Confidence level:confident
Coverage over the Query: 204-707,718-797
View the alignment between query and template
View the model in PyMOL