Citrus Sinensis ID: 003613


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------
MSTVTIRPLLPSYRRANLNFRDRTNILLKPNYINYSIKSAPNARRFCSFKKLQKITVSSSTSTSTSPATSTDTTPVRPGDVFFKETFPLKRTHAVEGKMFVRLQKGKDEKNWQLSVGCNIPGKWILHWGVSFVGDNGSEWDQPPKKMRPPGSVSIKDYAIETPLKKLAEGDVFDQVNIDFDTRSDIAAINFVLKDEETGAWYQHRGRDFKVPLVDYLQHDGNVIGTKSTFGLWPGALGQLSKMILKADTSQSGIQDSSSESCELKQENKHLEGFYEELPIVKEIIIENTVSVSVRKCPETAKTLLNLETDLTGDVVVHWGVCRDDSKNWEIPAEPYPPETIVFKNKALRTLLQPKEGGKGCSRLFTVDEEFAGFLFVLKLNENTWLKCMENDFYIPLTSSSCLPAESVQEMLIPGKAEEATQEVSQTAYTAGIIKEIRNLVSDFSSDISRKTKSKEAQKSILLEIEKLAAEAYSIFRTTAPTFFEEAAVELEESKPPAKISPGTGTGFEILCQGFNWESHKSGRWYMELKEKATELSSLGFSVIWLPPPTESVSPEGYMPRDLYNLSSRYGNIDELKDVVNKFHDVGMKILGDVVLNHRCAHYQNQNGVWNIFGGRLNWDDRAVVADDPHFQGRGNKSSGDNFHAAPNIDHSQDFVRKDIKEWLCWLRNEIGYDGWRLDFVRGFWGGYVKDYLEATEPYFAVGEYWDSLSYTYGEMDHNQDAHRQRIIDWINAASGTAGAFDVTTKGILHSALDRCEYWRLSDEKGKPPGVVGWWPSRAVTFIENHDTGSTQVRSSLCSTISQDFTY
ccccccccccHHHHccccccccccccccccccccccccccccccccccccccccCEEcccccccccccccccccccccccccEEEEEEcccEEEEccEEEEEEEccccccccEEEEECcccccEEEEEEEEEccccccccccccccccccccccccccEEcccccccccccccEEEEEEEccccccEEEEEEEECcccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEccccccEEEEEEccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEcccccEEEEEEEEccccccECccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHccccc
**TVTIRPLLPSYRRANLNFRDRTNILLKPNYINYSIKSAPNARRFCSFKKLQK***********************PGDVFFKETFPLKRTHAVEGKMFVRLQKGKDEKNWQLSVGCNIPGKWILHWGVSFVGDNGSEWD**********SVSIKDYAIETPLKKLAEGDVFDQVNIDFDTRSDIAAINFVLKDEETGAWYQHRGRDFKVPLVDYLQHDGNVIGTKSTFGLWPGALGQLSKMIL*************************LEGFYEELPIVKEIIIENTVSVSVRKCPETAKTLLNLETDLTGDVVVHWGVCRDDSKNWEIPAEPYPPETIVFKNKALRTLLQPKEGGKGCSRLFTVDEEFAGFLFVLKLNENTWLKCMENDFYIPLTS*************************SQTAYTAGIIKEIRNLVSD*****************ILLEIEKLAAEAYSIFRTTAPTFFEEAA**************GTGTGFEILCQGFNWESHKSGRWYMELKEKATELSSLGFSVIWLPPPTESVSPEGYMPRDLYNLSSRYGNIDELKDVVNKFHDVGMKILGDVVLNHRCAHYQNQNGVWNIFGGRLNWDDRAVVADDPHFQGRGNKSSGDNFHAAPNIDHSQDFVRKDIKEWLCWLRNEIGYDGWRLDFVRGFWGGYVKDYLEATEPYFAVGEYWDSLSYTYGEMDHNQDAHRQRIIDWINAASGTAGAFDVTTKGILHSALDRCEYWRLSDEKGKPPGVVGWWPSRAVTFIENHDTGSTQVRSSLCSTISQDFTY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVTIRPLLPSYRRANLNFRDRTNILLKPNYINYSIKSAPNARRFCSFKKLQKITVSSSTSTSTSPATSTDTTPVRPGDVFFKETFPLKRTHAVEGKMFVRLQKGKDEKNWQLSVGCNIPGKWILHWGVSFVGDNGSEWDQPPKKMRPPGSVSIKDYAIETPLKKLAEGDVFDQVNIDFDTRSDIAAINFVLKDEETGAWYQHRGRDFKVPLVDYLQHDGNVIGTKSTFGLWPGALGQLSKMILKADTSQSGIQDSSSESCELKQENKHLEGFYEELPIVKEIIIENTVSVSVRKCPETAKTLLNLETDLTGDVVVHWGVCRDDSKNWEIPAEPYPPETIVFKNKALRTLLQPKEGGKGCSRLFTVDEEFAGFLFVLKLNENTWLKCMENDFYIPLTSSSCLPAESVQEMLIPGKAEEATQEVSQTAYTAGIIKEIRNLVSDFSSDISRKTKSKEAQKSILLEIEKLAAEAYSIFRTTAPTFFEEAAVELEESKPPAKISPGTGTGFEILCQGFNWESHKSGRWYMELKEKATELSSLGFSVIWLPPPTESVSPEGYMPRDLYNLSSRYGNIDELKDVVNKFHDVGMKILGDVVLNHRCAHYQNQNGVWNIFGGRLNWDDRAVVADDPHFQGRGNKSSGDNFHAAPNIDHSQDFVRKDIKEWLCWLRNEIGYDGWRLDFVRGFWGGYVKDYLEATEPYFAVGEYWDSLSYTYGEMDHNQDAHRQRIIDWINAASGTAGAFDVTTKGILHSALDRCEYWRLSDEKGKPPGVVGWWPSRAVTFIENHDTGSTQVRSSLCSTISQDFTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-amylase 3, chloroplastic Possesses endoamylolytic activity in vitro, but seems not required for breakdown of transitory starch in leaves. May be involved in the determination of the final structure of glucans by shortening long linear phospho-oligosaccharides in the chloroplast stroma.probableQ94A41

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HT6, chain A
Confidence level:very confident
Coverage over the Query: 509-805
View the alignment between query and template
View the model in PyMOL
Template: 3BC9, chain A
Confidence level:confident
Coverage over the Query: 423-708,723-792
View the alignment between query and template
View the model in PyMOL