Citrus Sinensis ID: 003637

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800------
MASDSGFPSFNDGPSSPDDSISTPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccCEEECcHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEccccccEEccEEEcccccccccccccccccccccEEEEccccEEEccEEEEEEcccccccccccccCEEEEEEcccccccccccEEEEEEEEEECccccccccccccccEEEEEEEEEEEEcccccHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccEEccccccccccccEEEEECccccccEEEccccEEECcccEEEEEcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
********************************************************************************************************************PTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDD***GGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVE*********************KIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFEN****EQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYV***************ITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQ*********IDMDLI***********************************L*EVH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDSGFPSFNDGPSSPDDSISTPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM4 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.probableP49717
DNA replication licensing factor MCM4 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.probableP33991
DNA replication licensing factor mcm4 Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (By similarity). Required for S phase execution.probableP29458

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:confident
Coverage over the Query: 158-395,413-750
View the alignment between query and template
View the model in PyMOL