Citrus Sinensis ID: 003637

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800------
MASDSGFPSFNDGPSSPDDSISTPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccEEEEEcHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEccccccEEccEEEcccccccccccccccccccccEEEEccccEEEccEEEEEEcccccccccccccEEEEEEEcccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEEEEEEcccccHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccEEccccccccccccEEEEEEccccccEEEccccEEEEcccEEEEEcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHcccccHHccccccccccHHHHHHHHHHHHcccccEEEcHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHccHHHHHHEEEEcEEEEEccccccccEEEEEEccccccEEccEEEccccEEcccccccHHccccccEEEEEccEEEEccEEEEEEEcccccccccccccEEEEEEHHHHHccccccEEEEEEEEEccccccccccccccEEEEEEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHcccHccHHHHHHHHHHHHHcccccccccccEEcccEEEEEEcccccHHHHHHHHHHHHcccEEEEccccccEEEEEEEEEccccccEEEEEccHEEEccccEEEEEccccccHccHHHHHHHHHHHHHHHHHHcHEEEccHHHHHHHHcccccccccccccccccccccccHHcccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccEcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccEEHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHEEcc
masdsgfpsfndgpsspddsistpidntfsspagssrasgrgrgggrrrrrsttptafltpranqsrfatssetpnttpsrsnrrsngqrhatspsstddvplssseagddmdeatptfvwgtnisvqDVKSAIQMFLKHFREKeellsgseseiykegkYMRAINRVLEIegewidvdandvfdydsdlynkmVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLksstamrnlnpsdIEKMVSLKGMVIRCSSIIPEIREAIFRCLVcgyysdpivvdrgrinepstclkqeclaknsmTLVHNRCRFADKQIVRLqetpddipdggtphtVSLLMHDKlvdagkpgdrvevTGIYRAmsvrvgptqrTVKSLFKTYIDCLHIKKADKSRMLVEDAMeidnshpriedeiQFDESKIQQLKElsrqpniyetltrslapniwelddvKKGLLcqlfggnalklpsgasfrgdinillvgdpgtskSQLLQYIHklsprgiytsgkgssavgltayvtkdpetgetVLESGALvlsdrgiccidefDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLacanpsgsrynprlsvienihlpptllsRFDLIYLILDKADEQTDRRLAKHIVSLhfenpenseqgvLDLATLTAYVSYARkhihpklsdEAAEELTRGYVEmrrrgnfpgsskkvitaTPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQsatdhstgtidmdLITTGVSASERMRRENMVSSTRNIIMEKmqlggpsmrllevh
masdsgfpsfndgpsspddSISTPIdntfsspagssrasgrgrgggrrrrrsttptafltpranqsrfatssetpnttpsrsnrrsngqrhatspsstddvplsSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFrekeellsgseseiykegkYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNlksstamrnlnpSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQetpddipdgGTPHTVSLLMHDKLVDAGKPGDRVEVTGiyramsvrvgptqrtvkSLFKTYIDCLhikkadksrmLVEDAMEidnshpriedEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLhfenpenseqgVLDLATLTAYVSYARkhihpklsdeaAEELTRGYVEmrrrgnfpgsskkvitatprqiESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSatdhstgtidmDLITtgvsasermrrenmvsstrniimekmqlggpsmrllevh
MASDSGFPSFNdgpsspddsistpidNTFsspagssrasgrgrgggrrrrrsttptaFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRekeellsgseseIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH
********************************************************************************************************************PTFVWGTNISVQDVKSAIQMFLKHFREKEELLS***SEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQ************HTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKAD****************************************NIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDK*********HEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFEN****EQGVLDLATLTAYVSYARKHIHP******************************ITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAM***********IDMDLI****************************************
**********************************************************************************************************************FVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDD***GGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRA***************FKTYIDCLHIKKADKSRMLVE*********************KIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSL****************TLTAYVSYARKHIHPKLSDEAAEELTRGYV*****************ATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQ**************************************************L*EVH
******************DSISTPIDNT*************************TPTAFLTPRAN*********************************************DDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH
******************************************************************************************************************ATPTFVWGTNISVQDVKSAIQMFLKHFREKEEL*SGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADK***********************FDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNF***SKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRL**VH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDSGFPSFNDGPSSPDDSISTPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEVH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query806 2.2.26 [Sep-21-2011]
P29458931 DNA replication licensing yes no 0.946 0.819 0.468 0.0
P30665933 DNA replication licensing yes no 0.831 0.718 0.488 0.0
P33991863 DNA replication licensing yes no 0.808 0.755 0.508 0.0
P49717862 DNA replication licensing yes no 0.915 0.856 0.464 0.0
Q5XK83858 DNA replication licensing N/A no 0.926 0.870 0.460 0.0
P30664863 DNA replication licensing N/A no 0.930 0.869 0.460 0.0
Q6GL41863 DNA replication licensing yes no 0.930 0.869 0.460 0.0
Q26454866 DNA replication licensing yes no 0.933 0.868 0.444 0.0
Q9UXG1686 Minichromosome maintenanc yes no 0.751 0.883 0.342 1e-108
P55862735 DNA replication licensing N/A no 0.732 0.802 0.347 1e-100
>sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 Back     alignment and function desciption
 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/818 (46%), Positives = 553/818 (67%), Gaps = 55/818 (6%)

Query: 22  STPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSR 81
           S+P+    SSP  +   S R     +R       ++  TPR+ + R    S    +TPSR
Sbjct: 57  SSPLLFESSSPGPNIPQSSRSHLLSQRNDLFLDSSSQRTPRSTR-RGDIHSSVQMSTPSR 115

Query: 82  SNRRSNGQRHATS-PSS-----TDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQ 135
             R  + QR   S PSS     +D +  S +    ++ + T   +WGTN+S+Q+  ++ +
Sbjct: 116 -RREVDPQRPGVSTPSSLLFSGSDALTFSQAHPSSEVADDTVRVIWGTNVSIQESIASFR 174

Query: 136 MFLKHFREK------EELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFDY--D 187
            FL+ F++K       EL+   ++E   +  Y+ A+  +  +  E +++D  D+  Y   
Sbjct: 175 GFLRGFKKKYRPEYRNELMPPPDAE---QLVYIEALRNMRIMGLEILNLDVQDLKHYPPT 231

Query: 188 SDLYNKMVRYPLEVLAIFDIVLMDIV----------SLINPLFEKHVQVRIYNLKSSTAM 237
             LY+++  YP E++ I D  + D++           ++N +  K  ++R +NL+    M
Sbjct: 232 KKLYHQLYSYPQEIIPIMDQTIKDVMLDLLGTNPPEDVLNDIELKIYKIRPFNLEKCINM 291

Query: 238 RNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLK 297
           R+LNP DI+K++S+KG+V+RC+ +IP++++A FRC VCG+    + +DRGRI EP  C +
Sbjct: 292 RDLNPGDIDKLISIKGLVLRCTPVIPDMKQAFFRCSVCGHCVT-VEIDRGRIAEPIKCPR 350

Query: 298 QECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRV 357
           + C A N+M L+HNR  FADKQ+++LQETPD +PDG TPH+VSL ++D+LVD+ + GDR+
Sbjct: 351 EVCGATNAMQLIHNRSEFADKQVIKLQETPDVVPDGQTPHSVSLCVYDELVDSARAGDRI 410

Query: 358 EVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRM----------LVEDA-MEI 406
           EVTGI+R + VR+ P  RTVKSLFKTY+D +HIKK DK R+          + EDA ++I
Sbjct: 411 EVTGIFRCVPVRLNPRMRTVKSLFKTYVDVVHIKKQDKRRLGTDPSTLESDIAEDAALQI 470

Query: 407 DNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGN 466
           D    +I DE      ++++++++S++ +IY+ L+RSLAP+I+E+DDVKKGLL QLFGG 
Sbjct: 471 DEVR-KISDE------EVEKIQQVSKRDDIYDILSRSLAPSIYEMDDVKKGLLLQLFGGT 523

Query: 467 ALKLPSGAS--FRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVT 524
                 GAS  +RGDINIL+ GDP TSKSQ+L+Y+HK++PRG+YTSGKGSSAVGLTAY+T
Sbjct: 524 NKSFHKGASPRYRGDINILMCGDPSTSKSQILKYVHKIAPRGVYTSGKGSSAVGLTAYIT 583

Query: 525 KDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLN 584
           +D +T + VLESGALVLSD GICCIDEFDKMS++ RS+LHEVMEQQTV++AKAGII +LN
Sbjct: 584 RDQDTKQLVLESGALVLSDGGICCIDEFDKMSDATRSILHEVMEQQTVTVAKAGIITTLN 643

Query: 585 ARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVS 644
           ARTS+LA ANP GS+YNP L V +NI LPPTLLSRFDL+YLILD+ DE  DR+LA HIVS
Sbjct: 644 ARTSILASANPIGSKYNPDLPVTKNIDLPPTLLSRFDLVYLILDRVDETLDRKLANHIVS 703

Query: 645 LHFEN-PEN-SEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGS 702
           ++ E+ PE+ ++  V  +  LT+Y++YAR +I+P +S+EAA+EL   YV MR+ G    +
Sbjct: 704 MYMEDTPEHATDMEVFSVEFLTSYITYARNNINPVISEEAAKELVNAYVGMRKLGEDVRA 763

Query: 703 SKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTID 762
           S+K ITAT RQ+ES+IRLSEA A++ L  +VE  DV EA RL++ A++  ATD +TG I 
Sbjct: 764 SEKRITATTRQLESMIRLSEAHAKMHLRNVVEVGDVLEAARLIKTAIKDYATDPATGKIS 823

Query: 763 MDLITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSM 800
           +DLI   V+  E +  E+MV    N+I   + +GG +M
Sbjct: 824 LDLIY--VNERETLVPEDMVKELANLI-SNLTVGGKTM 858
Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (By similarity). Required for S phase execution.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 Back     alignment and function description
>sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 Back     alignment and function description
>sp|P49717|MCM4_MOUSE DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=2 SV=1 Back     alignment and function description
>sp|Q5XK83|MCM4A_XENLA DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-a PE=1 SV=1 Back     alignment and function description
>sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 Back     alignment and function description
>sp|Q6GL41|MCM4_XENTR DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1 Back     alignment and function description
>sp|Q26454|MCM4_DROME DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2 Back     alignment and function description
>sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 Back     alignment and function description
>sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS=Xenopus laevis GN=mcm5-a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query806
255543807867 DNA replication licensing factor MCM4, p 0.968 0.900 0.792 0.0
225427718840 PREDICTED: DNA replication licensing fac 0.972 0.933 0.814 0.0
42569072847 minichromosome maintenance protein 4 (ce 0.982 0.935 0.760 0.0
297744756834 unnamed protein product [Vitis vinifera] 0.965 0.932 0.806 0.0
297836690847 predicted protein [Arabidopsis lyrata su 0.982 0.935 0.762 0.0
224103353720 predicted protein [Populus trichocarpa] 0.863 0.966 0.863 0.0
356538731835 PREDICTED: DNA replication licensing fac 0.973 0.940 0.779 0.0
166079860834 minichromosome maintenance 4 protein [Pi 0.946 0.914 0.768 0.0
449461603844 PREDICTED: DNA replication licensing fac 0.985 0.940 0.782 0.0
357473435868 DNA replication licensing factor mcm4-B 0.947 0.880 0.748 0.0
>gi|255543807|ref|XP_002512966.1| DNA replication licensing factor MCM4, putative [Ricinus communis] gi|223547977|gb|EEF49469.1| DNA replication licensing factor MCM4, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1318 bits (3410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/850 (79%), Positives = 727/850 (85%), Gaps = 69/850 (8%)

Query: 1   MASDSGFPSFNDGPSSPDDSISTPIDNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLT 60
           MASDS    FN+GPSSPDDS S+PI NTFSSPA         RG  RR R S +  A+ T
Sbjct: 1   MASDS----FNNGPSSPDDSFSSPIGNTFSSPAT--------RGNTRRSRSSAS--AYAT 46

Query: 61  PRANQSRFATSSETPNTTPSRSNRRSNGQRHATS-PSSTDDVPLSSSEAGDDMDEATPTF 119
           P   QSRF  S  TP  TP    RRSNG   ATS PSS  +    SSE GDDM++ATPTF
Sbjct: 47  PPPPQSRFPASESTP--TP----RRSNGHHAATSTPSSMSEGVPPSSEGGDDMEDATPTF 100

Query: 120 VWGTNISVQDVKSAIQMFLKHFREKEELLSGSES---EIYKEGKYMRAINRVLEIEGEWI 176
           VWGTNISVQDVK  IQMFLKHFR+    L+ S+S   E+++EGKYM+ INRVLEIEGEW+
Sbjct: 101 VWGTNISVQDVKGKIQMFLKHFRD----LNKSQSQGAEVFEEGKYMKGINRVLEIEGEWL 156

Query: 177 DVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHVQVRIYNLKSSTA 236
           DVD +DVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLF+KHVQVRI+ LK+ST 
Sbjct: 157 DVDGHDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFDKHVQVRIFYLKTSTT 216

Query: 237 MRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCL 296
           MRNLNPSDIEKMVSLKGM+IRCSSIIPEIREAIFRCLVCGY SDPIVVDRGRINEP+ C 
Sbjct: 217 MRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGYLSDPIVVDRGRINEPTNCS 276

Query: 297 KQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDR 356
           K+ECLA+NSMTL+HNRCRFADKQIVRLQETPD+IP+GGTPHTVSLL+HDKLVD GKPGDR
Sbjct: 277 KEECLARNSMTLLHNRCRFADKQIVRLQETPDEIPEGGTPHTVSLLLHDKLVDTGKPGDR 336

Query: 357 VEVTGIYRAMSVRVGPTQRTVKSLFK-------------TYIDCLHIKKADKSRMLVEDA 403
           VEVTGIYRAMSVRVGPTQRTVKSLFK             TYIDCLHIKK DKSRM  E+ 
Sbjct: 337 VEVTGIYRAMSVRVGPTQRTVKSLFKAYMNIMVFSFCLQTYIDCLHIKKTDKSRMTTENP 396

Query: 404 MEIDNSHPRIEDEIQFDESK----------------------------IQQLKELSRQPN 435
           MEID+   R ED++QFDE+K                            I+QLKELS QP+
Sbjct: 397 MEIDDGLHRTEDDVQFDEAKACLSIFFSSGKNLCYCCLLGSYSCLNLQIKQLKELSEQPD 456

Query: 436 IYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQL 495
           IY+ LT+SLAPNIWELDDVK+GLLCQLFGGNA+KLPSGASFRGDINILLVGDPGTSKSQL
Sbjct: 457 IYDRLTKSLAPNIWELDDVKRGLLCQLFGGNAVKLPSGASFRGDINILLVGDPGTSKSQL 516

Query: 496 LQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKM 555
           LQYIHKLSPRGIYTSG+GSSAVGLTAYV+KDPETGETVLESGALVLSDRGICCIDEFDKM
Sbjct: 517 LQYIHKLSPRGIYTSGRGSSAVGLTAYVSKDPETGETVLESGALVLSDRGICCIDEFDKM 576

Query: 556 SESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPT 615
           SE+ARSMLHEVMEQQT+SIAKAGIIASLNARTSVLACANP GSRYNPRLSVI+NIHLPP+
Sbjct: 577 SENARSMLHEVMEQQTISIAKAGIIASLNARTSVLACANPIGSRYNPRLSVIDNIHLPPS 636

Query: 616 LLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIH 675
           LLSRFDLIYLILDKADEQTDR LAKHIVSLHFENPE+++  VLD+ATLTAY+SYARKHIH
Sbjct: 637 LLSRFDLIYLILDKADEQTDRHLAKHIVSLHFENPESAQHNVLDIATLTAYLSYARKHIH 696

Query: 676 PKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEK 735
           PKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIR SE VEK
Sbjct: 697 PKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRFSEWVEK 756

Query: 736 HDVEEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIMEKMQL 795
           HDV EAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRREN+VS+TRNIIMEK+QL
Sbjct: 757 HDVIEAFRLLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENLVSATRNIIMEKLQL 816

Query: 796 GGPSMRLLEV 805
           GGPSMRLLE+
Sbjct: 817 GGPSMRLLEI 826

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427718|ref|XP_002274534.1| PREDICTED: DNA replication licensing factor MCM4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42569072|ref|NP_179236.3| minichromosome maintenance protein 4 (cell division control protein 54) [Arabidopsis thaliana] gi|110741903|dbj|BAE98893.1| putative CDC21 protein [Arabidopsis thaliana] gi|330251403|gb|AEC06497.1| minichromosome maintenance protein 4 (cell division control protein 54) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297744756|emb|CBI38018.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297836690|ref|XP_002886227.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332067|gb|EFH62486.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224103353|ref|XP_002313023.1| predicted protein [Populus trichocarpa] gi|222849431|gb|EEE86978.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538731|ref|XP_003537854.1| PREDICTED: DNA replication licensing factor mcm4-B-like [Glycine max] Back     alignment and taxonomy information
>gi|166079860|gb|ABY81650.1| minichromosome maintenance 4 protein [Pisum sativum] Back     alignment and taxonomy information
>gi|449461603|ref|XP_004148531.1| PREDICTED: DNA replication licensing factor mcm4-like [Cucumis sativus] gi|449483538|ref|XP_004156619.1| PREDICTED: DNA replication licensing factor mcm4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357473435|ref|XP_003607002.1| DNA replication licensing factor mcm4-B [Medicago truncatula] gi|355508057|gb|AES89199.1| DNA replication licensing factor mcm4-B [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query806
TAIR|locus:2042674847 MCM4 "MINICHROMOSOME MAINTENAN 0.921 0.877 0.784 4.80000002038e-316
DICTYBASE|DDB_G0275623886 mcm4 "MCM family protein" [Dic 0.708 0.644 0.573 3.8e-183
CGD|CAL0001241912 CDC54 [Candida albicans (taxid 0.702 0.620 0.547 1.7e-176
POMBASE|SPCC16A11.17931 mcm4 "MCM complex subunit Mcm4 0.781 0.676 0.515 2.8e-176
UNIPROTKB|G3V681862 Mcm4 "RCG36531, isoform CRA_b" 0.863 0.807 0.487 4.5e-176
UNIPROTKB|J3KPV4850 MCM4 "DNA replication licensin 0.812 0.770 0.508 7.4e-176
UNIPROTKB|P33991863 MCM4 "DNA replication licensin 0.812 0.758 0.508 7.4e-176
UNIPROTKB|F6V1U9863 MCM4 "Uncharacterized protein" 0.864 0.807 0.479 3.2e-175
MGI|MGI:103199862 Mcm4 "minichromosome maintenan 0.811 0.758 0.505 1.4e-174
UNIPROTKB|E2QSM6866 MCM4 "Uncharacterized protein" 0.864 0.804 0.477 7.5e-174
TAIR|locus:2042674 MCM4 "MINICHROMOSOME MAINTENANCE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3031 (1072.0 bits), Expect = 4.8e-316, P = 4.8e-316
 Identities = 597/761 (78%), Positives = 667/761 (87%)

Query:    58 FLTPRANQSRFATSSETPNTT-PS--RSNRRSN--------GQRHATSPSSTDDVPLSSS 106
             F TP    SR A+S+ TP T+ PS  RS  R+         G     +P STD+ PL SS
Sbjct:    49 FATPPPPPSRLASSNSTPPTSRPSAARSKGRNGHGGGGGGGGGGDPGTPMSTDE-PLPSS 107

Query:   107 EAG--DDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRA 164
             + G  D  D+ TPTFVWGTNISVQDVKSAI+MF+KHFR            +++EGKYM +
Sbjct:   108 DDGEEDGGDDTTPTFVWGTNISVQDVKSAIEMFVKHFREARENSDD----LFREGKYMVS 163

Query:   165 INRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINPLFEKHV 224
             I +V+EIEGEWIDVDA DVFDYD DLYNKMVRYPLEVLAIFDIVLMDIVS IN LFEKHV
Sbjct:   164 IRKVIEIEGEWIDVDAFDVFDYDPDLYNKMVRYPLEVLAIFDIVLMDIVSTINRLFEKHV 223

Query:   225 QVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVV 284
             QVRI+NL++ST+MRNLNPSDIEKM+SLKGM+IR SSIIPEIREA+FRCLVCGY+SDPI+V
Sbjct:   224 QVRIFNLRTSTSMRNLNPSDIEKMISLKGMIIRSSSIIPEIREAVFRCLVCGYFSDPIIV 283

Query:   285 DRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMH 344
             DRG+I+EP TCLKQEC+ KNSMTLVHNRCRFADKQIVRLQETPD+IP+GGTPHTVSLL+H
Sbjct:   284 DRGKISEPPTCLKQECMTKNSMTLVHNRCRFADKQIVRLQETPDEIPEGGTPHTVSLLLH 343

Query:   345 DKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAM 404
             DKLVD GKPGDR+EVTGIYRAM+VRVGP  RTVKS+FKTYIDCLHIKKA K RM  ED M
Sbjct:   344 DKLVDNGKPGDRIEVTGIYRAMTVRVGPAHRTVKSVFKTYIDCLHIKKASKLRMSAEDPM 403

Query:   405 EIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFG 464
             ++DNS  R++++++ DE K+++ +ELS+QP+IYE L+RSLAPNIWELDDVKKGLLCQLFG
Sbjct:   404 DVDNSLRRVDEDVELDEEKLRKFQELSKQPDIYERLSRSLAPNIWELDDVKKGLLCQLFG 463

Query:   465 GNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVT 524
             GNAL L SGA+FRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSG+GSSAVGLTAYV 
Sbjct:   464 GNALNLASGANFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGRGSSAVGLTAYVA 523

Query:   525 KDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLN 584
             KDPETGETVLESGALVLSDRGICCIDEFDKMS+SARSMLHEVMEQQTVSIAKAGIIASLN
Sbjct:   524 KDPETGETVLESGALVLSDRGICCIDEFDKMSDSARSMLHEVMEQQTVSIAKAGIIASLN 583

Query:   585 ARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVS 644
             ARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDK DEQTDRRLAKHIV+
Sbjct:   584 ARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKPDEQTDRRLAKHIVA 643

Query:   645 LHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSK 704
             LHFEN E++++  +D+ TLT YVSYARK+IHPKLSDEAAEELTRGYVE+R+ G F GSSK
Sbjct:   644 LHFENAESAQEEAIDITTLTTYVSYARKNIHPKLSDEAAEELTRGYVELRKAGKFAGSSK 703

Query:   705 KVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVAMQQSATDHSTGTIDMD 764
             KVITATPRQIESLIRLSEALAR+R SE VEKHDV+EAFRLL VAMQQSATDH+TGTIDMD
Sbjct:   704 KVITATPRQIESLIRLSEALARMRFSEWVEKHDVDEAFRLLRVAMQQSATDHATGTIDMD 763

Query:   765 LITTGVSASERMRRENMVSSTRNIIMEKMQLGGPSMRLLEV 805
             LI TGVSASERMRR+   SS R+I +EKMQ+GG SMRL E+
Sbjct:   764 LINTGVSASERMRRDTFASSIRDIALEKMQIGGSSMRLSEL 804
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006260 "DNA replication" evidence=IEA;RCA
GO:0006270 "DNA replication initiation" evidence=IEA;ISS;RCA
GO:0008094 "DNA-dependent ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0006268 "DNA unwinding involved in replication" evidence=TAS
GO:0005829 "cytosol" evidence=IDA
GO:0000280 "nuclear division" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0007000 "nucleolus organization" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
DICTYBASE|DDB_G0275623 mcm4 "MCM family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0001241 CDC54 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPCC16A11.17 mcm4 "MCM complex subunit Mcm4/Cdc21" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G3V681 Mcm4 "RCG36531, isoform CRA_b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPV4 MCM4 "DNA replication licensing factor MCM4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P33991 MCM4 "DNA replication licensing factor MCM4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6V1U9 MCM4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:103199 Mcm4 "minichromosome maintenance deficient 4 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSM6 MCM4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33991MCM4_HUMAN3, ., 6, ., 4, ., 1, 20.50870.80890.7555yesno
P49717MCM4_MOUSE3, ., 6, ., 4, ., 1, 20.46420.91560.8561yesno
Q26454MCM4_DROME3, ., 6, ., 4, ., 1, 20.44450.93300.8683yesno
Q6GL41MCM4_XENTR3, ., 6, ., 4, ., 1, 20.46070.93050.8690yesno
P29458MCM4_SCHPO3, ., 6, ., 4, ., 1, 20.46820.94660.8195yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query806
smart00350509 smart00350, MCM, minichromosome maintenance protei 0.0
COG1241682 COG1241, MCM2, Predicted ATPase involved in replic 0.0
pfam00493327 pfam00493, MCM, MCM2/3/5 family 1e-179
PTZ00111915 PTZ00111, PTZ00111, DNA replication licensing fact 1e-174
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-10
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 3e-07
COG1239423 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme 1e-06
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-05
TIGR02031 589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 4e-04
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information 
 Score =  676 bits (1747), Expect = 0.0
 Identities = 256/517 (49%), Positives = 347/517 (67%), Gaps = 19/517 (3%)

Query: 237 MRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRINEPSTCL 296
           +R L    + K+V + G+V R S + P+++ A F C  CG    P  +  GR  EP+ C 
Sbjct: 5   IRELRADHLGKLVRISGIVTRTSGVRPKLKRASFTCEKCGATLGP-EIQSGRETEPTVCP 63

Query: 297 KQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDR 356
            +EC +    +L H R  F D Q ++LQE+P+++P G  P +V +++   LVD  KPGDR
Sbjct: 64  PRECQSPTPFSLNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDR 123

Query: 357 VEVTGIYRAMSVRVGPTQRTVKSL--FKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIE 414
           VEVTGIYR  +V  G    TVK L  F TYI+  H++K D  +   ED+     S     
Sbjct: 124 VEVTGIYR--NVPYGFKLNTVKGLPVFATYIEANHVRKLDY-KRSFEDSSFSVQS----- 175

Query: 415 DEIQFDESKIQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGA 474
                 + + +++++LS+ P+IYE L RSLAP+I+  +D+KK +L  LFGG    LP G 
Sbjct: 176 ----LSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGM 231

Query: 475 SFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGKGSSAVGLTAYVTKDPETGETVL 534
             RGDINILL GDPGT+KSQLL+Y+ K +PR +YT+GKGSSAVGLTA VT+DPET E  L
Sbjct: 232 KIRGDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTL 291

Query: 535 ESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASLNARTSVLACAN 594
           E+GALVL+D G+CCIDEFDKM +S R+ +HE MEQQT+SIAKAGI  +LNAR SVLA AN
Sbjct: 292 EAGALVLADNGVCCIDEFDKMDDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAAN 351

Query: 595 PSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFEN-PENS 653
           P G RY+P+L+  ENI LP  +LSRFDL++++LD+ DE+ DR LAKH+V LH  + PE  
Sbjct: 352 PIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVVDLHRYSHPEED 411

Query: 654 EQ--GVLDLATLTAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATP 711
           E     L    L  Y++YAR+ I PKLS+EAA++L + YV++R+  +    S+  I  T 
Sbjct: 412 EAFEPPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDS-QTESRSSIPITV 470

Query: 712 RQIESLIRLSEALARIRLSELVEKHDVEEAFRLLEVA 748
           RQ+ES+IRLSEA A++RLS++VE+ DVEEA RLL  +
Sbjct: 471 RQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRES 507

Length = 509
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|224160 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 806
KOG0478804 consensus DNA replication licensing factor, MCM4 c 100.0
KOG0480764 consensus DNA replication licensing factor, MCM6 c 100.0
PTZ00111915 DNA replication licensing factor MCM4; Provisional 100.0
COG1241682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0481729 consensus DNA replication licensing factor, MCM5 c 100.0
KOG0482721 consensus DNA replication licensing factor, MCM7 c 100.0
KOG0477854 consensus DNA replication licensing factor, MCM2 c 100.0
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 100.0
smart00350509 MCM minichromosome maintenance proteins. 100.0
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 100.0
COG2204464 AtoC Response regulator containing CheY-like recei 99.93
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.92
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.92
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.92
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.91
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.91
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.91
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.9
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.9
PRK09862506 putative ATP-dependent protease; Provisional 99.9
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.87
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.86
PRK13531 498 regulatory ATPase RavA; Provisional 99.86
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.82
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.82
COG0714329 MoxR-like ATPases [General function prediction onl 99.81
COG1221403 PspF Transcriptional regulators containing an AAA- 99.79
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.79
PRK15424538 propionate catabolism operon regulatory protein Pr 99.79
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.78
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.78
PRK11608326 pspF phage shock protein operon transcriptional ac 99.78
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.77
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.77
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.76
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.76
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.75
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.74
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.73
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.73
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.73
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.73
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.72
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.72
PRK15115444 response regulator GlrR; Provisional 99.71
PF07726131 AAA_3: ATPase family associated with various cellu 99.71
PF14551121 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1 99.7
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.69
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.69
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.67
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.65
CHL00181287 cbbX CbbX; Provisional 99.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.65
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.61
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.58
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.57
PRK13765 637 ATP-dependent protease Lon; Provisional 99.55
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.54
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.5
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.5
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.5
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.49
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.49
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.49
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.48
PHA02244383 ATPase-like protein 99.44
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.43
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.4
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.4
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.39
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.38
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK03992389 proteasome-activating nucleotidase; Provisional 99.36
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.34
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.33
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.32
CHL00195489 ycf46 Ycf46; Provisional 99.31
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.3
PLN03025319 replication factor C subunit; Provisional 99.3
PRK13341 725 recombination factor protein RarA/unknown domain f 99.3
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.28
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.28
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.28
PRK13342 413 recombination factor protein RarA; Reviewed 99.27
CHL00176 638 ftsH cell division protein; Validated 99.26
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.25
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.25
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.25
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.24
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.23
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.23
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.23
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.23
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.22
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.21
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.21
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.2
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.2
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.2
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.2
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.19
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.19
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.19
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.18
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.18
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.17
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.17
PRK10865857 protein disaggregation chaperone; Provisional 99.17
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.16
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.14
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.14
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.14
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.14
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.13
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.12
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.12
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.12
CHL00095821 clpC Clp protease ATP binding subunit 99.11
CHL00095 821 clpC Clp protease ATP binding subunit 99.1
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.1
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.1
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK12402337 replication factor C small subunit 2; Reviewed 99.1
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.09
PRK00440319 rfc replication factor C small subunit; Reviewed 99.09
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.08
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.07
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.07
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.06
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.06
KOG2028554 consensus ATPase related to the helicase subunit o 99.05
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.03
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.02
PRK10865 857 protein disaggregation chaperone; Provisional 99.02
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.01
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.01
CHL00206 2281 ycf2 Ycf2; Provisional 99.01
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.0
PTZ001121164 origin recognition complex 1 protein; Provisional 98.98
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.98
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.98
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.97
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.97
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.96
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.96
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.96
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.95
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.95
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.94
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.92
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.89
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.88
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 98.88
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.87
PHA02544316 44 clamp loader, small subunit; Provisional 98.87
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.86
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.85
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.83
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.82
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.81
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.8
PF00004132 AAA: ATPase family associated with various cellula 98.78
PRK06620214 hypothetical protein; Validated 98.78
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 98.78
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.77
PRK04195 482 replication factor C large subunit; Provisional 98.77
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.76
PRK06893229 DNA replication initiation factor; Validated 98.72
PRK08084235 DNA replication initiation factor; Provisional 98.72
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.7
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.69
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 98.67
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.67
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.66
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.65
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.64
PRK12422445 chromosomal replication initiation protein; Provis 98.63
PRK08727233 hypothetical protein; Validated 98.62
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.62
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 98.62
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.56
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.56
PRK04132846 replication factor C small subunit; Provisional 98.55
PRK07940394 DNA polymerase III subunit delta'; Validated 98.53
PRK09087226 hypothetical protein; Validated 98.51
PRK00149450 dnaA chromosomal replication initiation protein; R 98.51
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.46
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 98.43
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.42
PRK14088440 dnaA chromosomal replication initiation protein; P 98.41
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.41
PRK14086617 dnaA chromosomal replication initiation protein; P 98.41
PRK14087450 dnaA chromosomal replication initiation protein; P 98.41
PRK09112351 DNA polymerase III subunit delta'; Validated 98.39
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 98.39
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.39
PF13337457 Lon_2: Putative ATP-dependent Lon protease 98.37
PRK05642234 DNA replication initiation factor; Validated 98.36
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 98.36
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.33
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.32
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.3
PRK05564313 DNA polymerase III subunit delta'; Validated 98.29
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.29
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.27
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.25
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.25
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.16
PHA01747425 putative ATP-dependent protease 98.16
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.16
smart00382148 AAA ATPases associated with a variety of cellular 98.14
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.11
PRK07471365 DNA polymerase III subunit delta'; Validated 98.08
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.08
PRK08058329 DNA polymerase III subunit delta'; Validated 98.07
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.06
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 98.06
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.04
PRK07399314 DNA polymerase III subunit delta'; Validated 98.01
PRK15455 644 PrkA family serine protein kinase; Provisional 98.0
PRK05707328 DNA polymerase III subunit delta'; Validated 97.96
COG0593408 DnaA ATPase involved in DNA replication initiation 97.74
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.73
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.69
KOG0736 953 consensus Peroxisome assembly factor 2 containing 97.66
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.66
KOG2545543 consensus Conserved membrane protein [Function unk 97.55
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 97.5
PRK06871325 DNA polymerase III subunit delta'; Validated 97.49
PRK12377248 putative replication protein; Provisional 97.47
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.47
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.44
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 97.42
PRK08181269 transposase; Validated 97.4
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.38
PRK08769319 DNA polymerase III subunit delta'; Validated 97.34
PRK06526254 transposase; Provisional 97.33
PRK08116268 hypothetical protein; Validated 97.33
PRK07993334 DNA polymerase III subunit delta'; Validated 97.31
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 97.29
PRK06964342 DNA polymerase III subunit delta'; Validated 97.29
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.28
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.24
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.19
PRK08699325 DNA polymerase III subunit delta'; Validated 97.0
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.93
PF13148378 DUF3987: Protein of unknown function (DUF3987) 96.9
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 96.89
PRK09183259 transposase/IS protein; Provisional 96.88
PHA02774613 E1; Provisional 96.86
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 96.84
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 96.83
PRK06090319 DNA polymerase III subunit delta'; Validated 96.81
PRK07952244 DNA replication protein DnaC; Validated 96.8
KOG2170344 consensus ATPase of the AAA+ superfamily [General 96.76
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.74
PRK06835329 DNA replication protein DnaC; Validated 96.73
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.69
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.68
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.66
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.53
PRK06921266 hypothetical protein; Provisional 96.47
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 96.34
PRK08939306 primosomal protein DnaI; Reviewed 96.26
PRK05917290 DNA polymerase III subunit delta'; Validated 96.2
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.12
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 96.11
PHA02624647 large T antigen; Provisional 96.03
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 95.93
PF13173128 AAA_14: AAA domain 95.9
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.8
PRK07132299 DNA polymerase III subunit delta'; Validated 95.8
PF05729166 NACHT: NACHT domain 95.73
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.62
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.38
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.33
COG4930 683 Predicted ATP-dependent Lon-type protease [Posttra 95.23
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.17
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.15
PRK05818261 DNA polymerase III subunit delta'; Validated 95.11
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.05
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 94.94
PRK13947171 shikimate kinase; Provisional 94.84
COG4178604 ABC-type uncharacterized transport system, permeas 94.8
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.79
PHA00729226 NTP-binding motif containing protein 94.75
PRK14532188 adenylate kinase; Provisional 94.67
PRK04296190 thymidine kinase; Provisional 94.64
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 94.63
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 94.61
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.6
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.47
PRK07276290 DNA polymerase III subunit delta'; Validated 94.44
PRK00131175 aroK shikimate kinase; Reviewed 94.34
PRK08118167 topology modulation protein; Reviewed 94.33
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 94.32
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.3
PRK00625173 shikimate kinase; Provisional 94.25
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.21
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 94.1
PRK03839180 putative kinase; Provisional 94.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.02
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.96
PRK13949169 shikimate kinase; Provisional 93.89
PRK10875 615 recD exonuclease V subunit alpha; Provisional 93.89
PTZ00088229 adenylate kinase 1; Provisional 93.87
PRK07261171 topology modulation protein; Provisional 93.8
PRK14530215 adenylate kinase; Provisional 93.77
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.72
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.72
PRK06762166 hypothetical protein; Provisional 93.25
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.25
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.23
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 93.19
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 93.16
PRK05057172 aroK shikimate kinase I; Reviewed 93.13
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 93.13
PRK06217183 hypothetical protein; Validated 93.11
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.1
PF1324576 AAA_19: Part of AAA domain 93.06
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.05
PRK14531183 adenylate kinase; Provisional 93.03
PRK14700 300 recombination factor protein RarA; Provisional 92.92
PRK13826 1102 Dtr system oriT relaxase; Provisional 92.92
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.9
cd01878204 HflX HflX subfamily. A distinct conserved domain w 92.86
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 92.83
COG4619223 ABC-type uncharacterized transport system, ATPase 92.82
PRK13889 988 conjugal transfer relaxase TraA; Provisional 92.81
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 92.7
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.64
PRK14709469 hypothetical protein; Provisional 92.63
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.57
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 92.56
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 92.53
PRK14528186 adenylate kinase; Provisional 92.51
PRK14526211 adenylate kinase; Provisional 92.42
PLN02200234 adenylate kinase family protein 92.4
PRK03846198 adenylylsulfate kinase; Provisional 92.39
PRK13946184 shikimate kinase; Provisional 92.26
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.26
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 92.22
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 92.21
COG0703172 AroK Shikimate kinase [Amino acid transport and me 92.12
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 92.11
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.08
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.04
PRK03731171 aroL shikimate kinase II; Reviewed 92.01
PRK02496184 adk adenylate kinase; Provisional 92.0
PRK08233182 hypothetical protein; Provisional 91.9
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 91.79
PRK13948182 shikimate kinase; Provisional 91.78
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 91.77
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.69
PRK06851367 hypothetical protein; Provisional 91.64
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 91.6
PRK00279215 adk adenylate kinase; Reviewed 91.56
PF09439181 SRPRB: Signal recognition particle receptor beta s 91.51
PF1355562 AAA_29: P-loop containing region of AAA domain 91.43
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.41
KOG2383467 consensus Predicted ATPase [General function predi 91.38
PRK14529223 adenylate kinase; Provisional 91.36
PRK06581263 DNA polymerase III subunit delta'; Validated 91.33
PRK14527191 adenylate kinase; Provisional 91.3
PRK05439311 pantothenate kinase; Provisional 91.3
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 91.26
PHA02530300 pseT polynucleotide kinase; Provisional 91.23
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.23
PRK13851344 type IV secretion system protein VirB11; Provision 91.17
KOG18051100 consensus DNA replication helicase [Replication, r 91.08
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 91.06
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.0
PRK04040188 adenylate kinase; Provisional 90.96
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 90.96
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 90.92
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 90.78
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 90.71
PRK00300205 gmk guanylate kinase; Provisional 90.64
PF13479213 AAA_24: AAA domain 90.61
PLN02459261 probable adenylate kinase 90.57
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 90.5
PLN02674244 adenylate kinase 90.47
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 90.37
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.3
PRK05541176 adenylylsulfate kinase; Provisional 90.26
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.25
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 90.18
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 90.1
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 90.03
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 89.98
PRK08154309 anaerobic benzoate catabolism transcriptional regu 89.92
PRK12339197 2-phosphoglycerate kinase; Provisional 89.76
COG4088261 Predicted nucleotide kinase [Nucleotide transport 89.75
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 89.74
PRK08485206 DNA polymerase III subunit delta'; Validated 89.73
PRK06547172 hypothetical protein; Provisional 89.72
COG1485367 Predicted ATPase [General function prediction only 89.69
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 89.67
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 89.63
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 89.61
TIGR00231161 small_GTP small GTP-binding protein domain. This m 89.61
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 89.6
PRK04182180 cytidylate kinase; Provisional 89.51
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 89.43
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.42
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 89.42
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 89.4
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 89.37
PRK01184184 hypothetical protein; Provisional 89.36
PLN02165334 adenylate isopentenyltransferase 89.32
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 89.31
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 89.27
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 89.26
PRK05480209 uridine/cytidine kinase; Provisional 89.23
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 89.21
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 89.2
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 89.18
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 89.16
cd00154159 Rab Rab family. Rab GTPases form the largest famil 89.15
TIGR00235207 udk uridine kinase. Model contains a number of lon 89.14
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 89.04
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 89.01
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 88.97
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 88.96
PRK00889175 adenylylsulfate kinase; Provisional 88.81
PRK09825176 idnK D-gluconate kinase; Provisional 88.73
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.57
PRK13833323 conjugal transfer protein TrbB; Provisional 88.5
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 88.47
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 88.46
PRK10536262 hypothetical protein; Provisional 88.42
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 88.42
TIGR02237209 recomb_radB DNA repair and recombination protein R 88.3
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 88.29
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 88.27
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 88.21
PRK00771437 signal recognition particle protein Srp54; Provisi 88.16
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 88.16
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 88.13
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 88.04
cd00876160 Ras Ras family. The Ras family of the Ras superfam 88.02
PRK14737186 gmk guanylate kinase; Provisional 87.99
PRK13695174 putative NTPase; Provisional 87.99
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 87.94
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 87.85
PF00005137 ABC_tran: ABC transporter This structure is on hol 87.79
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 87.78
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 87.66
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 87.66
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 87.64
PRK14738206 gmk guanylate kinase; Provisional 87.64
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 87.59
PRK13975196 thymidylate kinase; Provisional 87.58
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 87.56
PRK13894319 conjugal transfer ATPase TrbB; Provisional 87.53
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 87.51
PLN02199303 shikimate kinase 87.5
COG5545517 Predicted P-loop ATPase and inactivated derivative 87.47
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 87.46
PRK08356195 hypothetical protein; Provisional 87.35
COG1117253 PstB ABC-type phosphate transport system, ATPase c 87.32
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 87.32
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 87.32
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 87.29
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 87.22
PRK13808333 adenylate kinase; Provisional 87.19
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 87.18
COG3842352 PotA ABC-type spermidine/putrescine transport syst 87.16
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 87.14
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 87.14
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 87.12
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 87.11
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 87.08
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 87.02
PRK12608380 transcription termination factor Rho; Provisional 86.99
PRK10416318 signal recognition particle-docking protein FtsY; 86.92
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 86.81
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 86.8
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 86.71
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 86.69
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 86.66
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 86.61
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 86.54
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 86.52
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 86.52
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 86.5
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 86.44
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 86.4
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 86.34
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 86.31
PRK09361225 radB DNA repair and recombination protein RadB; Pr 86.3
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 86.28
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 86.28
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=8.3e-141  Score=1166.93  Aligned_cols=716  Identities=53%  Similarity=0.822  Sum_probs=646.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCccccccCCCCcccCCCCCCCCcCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCC
Q 003637           26 DNTFSSPAGSSRASGRGRGGGRRRRRSTTPTAFLTPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSSTDDVPLSS  105 (806)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  105 (806)
                      +.+..+||+|   +|++.+....+.+..+|++|+||+..  ..|.|....|| |  .+            ++......- 
T Consensus        52 ~~~~~~~a~~---~~~~~~~s~~~~d~~sp~~~~~p~~~--~~~~~~~~~tP-r--~~------------l~~~~~~~~-  110 (804)
T KOG0478|consen   52 GANSVPPATS---AGKRGRNSHLDSDFASPLNYSTPSSG--LDPQSGDVGTP-R--GD------------LGFSLVFIR-  110 (804)
T ss_pred             CCCCCCcccc---ccccCCCCcccccccCccccCCcccC--CCcccccCCCC-C--cc------------cccceeeee-
Confidence            4455556664   34555555666777999999999987  56666666666 2  11            110100000 


Q ss_pred             CcCCCCCCCCCceEEEccCCCHHHHHHHHHHHHHhcccccccccCCcccccchhhHHHHHHHHHHcCCcEEEEechhhhc
Q 003637          106 SEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEIEGEWIDVDANDVFD  185 (806)
Q Consensus       106 ~~~~~~~~~~~~~~~~g~~i~~~~~~~~f~~FL~~F~~~~~~~~~~~~~~~~~~~Y~~~i~~~~~~~~~~l~Vd~~dL~~  185 (806)
                       + .++...+..++||||+++++++.+.|+.||.+|...          .....+|++.|.++...+...+++|..||..
T Consensus       111 -~-~~~~~~~~~~~Iwgt~v~iqe~~~~F~~fl~rf~~~----------d~~~~~yi~~l~e~~~~~~~~ln~~~~hl~~  178 (804)
T KOG0478|consen  111 -E-VQEVGNEPALVIWGTNVNIQECPENFDDFLRRFRGI----------DPLCPYYIKSLLELKELEPEFLNLDAEHLTD  178 (804)
T ss_pred             -e-eeecCCcceEEEEeeEEEHHhhhhHHHHHHHhcCCC----------CccchHHHHHHHHHHHhhhhhhhhhhhcccc
Confidence             0 111233678999999999999999999999999542          2336889999999999999999999999999


Q ss_pred             cCHHHHHHHHhCHHHHHHHHHHHHHHHHHhhC--cccCCcEEEEEeecCCccCCCCCCccCCCceEEEEEEEEEecccce
Q 003637          186 YDSDLYNKMVRYPLEVLAIFDIVLMDIVSLIN--PLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIP  263 (806)
Q Consensus       186 fd~~L~~~l~~~P~e~l~~~d~al~~~~~~~~--~~~~~~i~vr~~nl~~~~~iR~L~~~~igkLV~i~GiV~r~S~v~p  263 (806)
                      |+.+||.+++.||.|++|.|+.++++++.+.+  ..+.+.++||++|+.++.+||+|++.+|+|||+|+|+|+|+|+|.|
T Consensus       179 ~~~~Ly~ql~~ypqevip~~d~t~~~~~~e~~~~~~~~~~i~vRPfn~~~~~smr~lNp~dIDkLisI~GmViRss~vip  258 (804)
T KOG0478|consen  179 FDMDLYRQLVVYPQEVIPIFDETANEIVLERYVLEILEKSIKVRPFNAGKTFSMRNLNPNDIDKLISISGMVIRSSEVIP  258 (804)
T ss_pred             ccHHHHHhhhhchHhhcccchHHHHHHHHhhccccchhceeEeeccCcccccccccCChhhhhheEEeeeEEEecCCCCH
Confidence            99999999999999999999999999988877  4567899999999999999999999999999999999999999999


Q ss_pred             eEEEEEEEecccCccCCceEecCCcccCCcccCccccCCCCceeEeccccccceeeEEEEeeCCCCCCCCCCCeEEEEEe
Q 003637          264 EIREAIFRCLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLM  343 (806)
Q Consensus       264 ~l~~a~f~C~~C~~~~~~~~~~~~~~~~P~~C~~~~C~~~~~~~l~~~~s~f~d~Q~IkiQE~~~~~p~G~~Prti~v~l  343 (806)
                      ++++++|+|..|++... +..++|++.+|..|.  .|+.++.|+++|++|+|.|+|.||+||+|+.+|.|++|++|.|++
T Consensus       259 em~~afFrC~vC~~~~~-ve~drg~i~eP~~C~--~C~~~~~~~Lihnrs~F~dkQviklqEspd~~p~g~tPhtv~v~~  335 (804)
T KOG0478|consen  259 EMVEAFFRCSVCGHEIA-VESDRGRIKEPMLCK--ECGTTNSFQLLHNRSEFADKQVIKLQESPDDMPEGSTPHTVSVVL  335 (804)
T ss_pred             HHHhHhhhhhhcCceEE-EEeecCccCCCcccc--cccCcccceeehhhhhhcccceeeeeeccccCcCCCCCceEEEEE
Confidence            99999999999999998 788899999999996  599999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCCEEEEEEEEEeeeeccCCCcccccceeeEEEEEEEEEEcccccccccccccccCCCCCcccccCCCHHH
Q 003637          344 HDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESK  423 (806)
Q Consensus       344 ~~dLvd~~~pGd~V~VtGIl~~~~~~~~~~~~~~~~~~~~yi~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  423 (806)
                      ++||||+|+|||+|.|||||++.+.+.++..+..+++|++||+++||++.+..+....+..+  +       +-.+..++
T Consensus       336 ~~dLVD~v~pGDrv~VTGi~ra~p~r~np~~r~vkSvyktyldvvh~rk~s~~rl~~~d~~d--~-------~~~~~~~~  406 (804)
T KOG0478|consen  336 HNDLVDKVRPGDRVEVTGILRATPVRVNPRMRMVKSVYKTYLDVVHIRKASMKRLEGSDERD--V-------DEVRRIED  406 (804)
T ss_pred             ehhhhhccCCCCeEEEEEEEEeEEeccCcchhhHHHHHHHHhHhhhhhhhhhhhcccccccc--c-------cccccHHH
Confidence            99999999999999999999999999999999999999999999999999887654322111  1       23567788


Q ss_pred             HHHHHHHhcChhHHHHHHHhhcccccchhhhHHHHhhhhcCCccccCCCCCccccccceEEECCCCChHHHHHHHHHHHC
Q 003637          424 IQQLKELSRQPNIYETLTRSLAPNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLS  503 (806)
Q Consensus       424 ~~~i~~l~~~~~~~~~l~~si~P~I~G~e~vK~~ill~L~g~~~~~~~~~~~~rg~invLLvG~PGtGKS~la~~ia~~~  503 (806)
                      +++|.++++.||+|+.|++||||+|||||++|+||||+||||+.+....+.++||+|||||+||||||||||++++|+++
T Consensus       407 ~e~i~elskrpdiy~lLa~SiAPsIye~edvKkglLLqLfGGt~k~~~~~~~~R~~INILL~GDPGtsKSqlLqyv~~l~  486 (804)
T KOG0478|consen  407 LEKIQELSKRPDIYELLARSIAPSIYELEDVKKGLLLQLFGGTRKEDEKSGRFRGDINILLVGDPGTSKSQLLQYCHRLL  486 (804)
T ss_pred             HHHHHHHhcCccHHHHHHHhhchhhhcccchhhhHHHHHhcCCcccccccccccccceEEEecCCCcCHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999998887799999999999999999999999999999


Q ss_pred             CCCeeccCCCcccccceeeeecCCCCCccccccccccccCCceeeccccccCCHHHHHHHHHHHhhcEEEEeecceeeee
Q 003637          504 PRGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLHEVMEQQTVSIAKAGIIASL  583 (806)
Q Consensus       504 pr~~~t~g~~~~~~glta~~~k~~~~ge~~le~Gal~lAd~GIl~IDEidkm~~~~~~~L~e~Me~q~isi~kag~~~~l  583 (806)
                      ||++||+|+|++++|||+.+.+|+.+++|+++.|+|+++|+|||||||||||+...|+.|||+||||+++|+|||+.++|
T Consensus       487 pRg~yTSGkGsSavGLTayVtrd~dtkqlVLesGALVLSD~GiCCIDEFDKM~dStrSvLhEvMEQQTvSIAKAGII~sL  566 (804)
T KOG0478|consen  487 PRGVYTSGKGSSAVGLTAYVTKDPDTRQLVLESGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIIASL  566 (804)
T ss_pred             CcceeecCCccchhcceeeEEecCccceeeeecCcEEEcCCceEEchhhhhhhHHHHHHHHHHHHHhhhhHhhcceeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCceEEEEecCCCCCCCCCCCcccccccCCccccCcchhhhhhccCCChHHHHHHHHHHHHhhhcCCCCccCCCCCHHHH
Q 003637          584 NARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATL  663 (806)
Q Consensus       584 ~~~~siIAAaNp~~g~~~~~~~~~~~i~lp~~LlsRFDli~il~d~~~~~~d~~la~~il~~~~~~~~~~~~~~i~~~~L  663 (806)
                      |+|++||||+||..++||+++++.+||+||++|+|||||||+++|.+|+..|+.|+.|++.+|.+.........++...|
T Consensus       567 NAR~SVLAaANP~~skynp~k~i~eNI~LpptLLSRFDLIylllD~~DE~~Dr~La~HivsLy~e~~~~~~~~~~d~~~l  646 (804)
T KOG0478|consen  567 NARCSVLAAANPIRSKYNPNKSIIENINLPPTLLSRFDLIFLLLDKPDERSDRRLADHIVALYPETGEKQGSEAIDMNLL  646 (804)
T ss_pred             cccceeeeeeccccccCCCCCchhhccCCChhhhhhhcEEEEEecCcchhHHHHHHHHHHHhcccccccchhHHHhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998766566778999999


Q ss_pred             HHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHhcCCCCCCCCcccccCHHHHHHHHHHHHHHHHHhcCCCCCHhhHHHHHH
Q 003637          664 TAYVSYARKHIHPKLSDEAAEELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFR  743 (806)
Q Consensus       664 k~yi~~ar~~~~p~ls~ea~~~L~~~y~~lR~~~~~~gn~~~~~~it~R~Leslirla~a~A~l~~~~~V~~~Dv~~ai~  743 (806)
                      +.||.||+++++|.+++||.+.+.++|+.+|+.+...+    .+..|+||||+|+|+++|||++++++.|...||++|++
T Consensus       647 r~yi~yArk~i~p~l~~ea~~~l~~ayvd~rk~~~~~~----~itat~rQlesLiRlsEahak~r~s~~ve~~dV~eA~~  722 (804)
T KOG0478|consen  647 RDYIRYARKNIHPALSPEASQALIQAYVDMRKIGEGAG----QITATPRQLESLIRLSEAHAKMRLSNRVEEIDVEEAVR  722 (804)
T ss_pred             HHHHHHHhccCCccccHHHHHHHHHHhhhhhhhccccc----ccchhHHHHHHHHHHHHHHHHhhcccccchhhHHHHHH
Confidence            99999999999999999999999999999999764433    45678999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhccCCCCCchhhHhhhCCchhHHHHHHHHHHHHHHHHH
Q 003637          744 LLEVAMQQSATDHSTGTIDMDLITTGVSASERMRRENMVSSTRNIIM  790 (806)
Q Consensus       744 l~~~sl~~~~~~~~~g~~d~~~~~~g~s~~~~~~~~~~~~~i~~~~~  790 (806)
                      +.+.++.+.+.|+.+|.+|++++.+|.+...++.++.+.+++..+++
T Consensus       723 l~R~aL~~~a~d~~tg~vd~~~l~tg~s~~~~~~~~~~~~ai~~~l~  769 (804)
T KOG0478|consen  723 LLREALKQSATDPATGKVDMDILATGNSVVSRKKVEILGGAILKMLK  769 (804)
T ss_pred             HHHHHhcccCCCCCCCceeehhhhhcccccchHHHHHHHHHHHHHhH
Confidence            99999999999999999999999999988888888877777765554

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF14551 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1LTL_E Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2545 consensus Conserved membrane protein [Function unknown] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13148 DUF3987: Protein of unknown function (DUF3987) Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14709 hypothetical protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>COG5545 Predicted P-loop ATPase and inactivated derivatives [General function prediction only] Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query806
3f9v_A595 Crystal Structure Of A Near Full-Length Archaeal Mc 1e-104
3f8t_A506 Crystal Structure Analysis Of A Full-Length Mcm Hom 9e-27
2vl6_A268 Structural Analysis Of The Sulfolobus Solfataricus 9e-18
1ltl_A279 The Dodecamer Structure Of Mcm From Archaeal M. The 2e-16
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure 
Iteration: 1

 Score =  375 bits (964), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 213/606 (35%), Positives = 357/606 (58%), Gaps = 47/606 (7%)
Query: 158 EGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLIN 217
           + KY+  IN ++    + + ++ +DV  ++ +L  +++     +L I +  L D +  ++
Sbjct: 21  QNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLD 80
Query: 218 PLFEK---HVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFR--- 271
           P +++    V VRI  +     +R +  +DI K++++ G++++ + +   I +A ++   
Sbjct: 81  PTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIH 140
Query: 272 --CLVCGYYSD----PIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQE 325
             C+    + +    P V++      P+ C K  C       L+  + +  D Q   +QE
Sbjct: 141 PDCMQEFEWPEDEEMPEVLEM-----PTICPK--CGKPGQFRLIPEKTKLIDWQKAVIQE 193
Query: 326 TPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRV-GPTQRTVKSLFKTY 384
            P+++P G  P  + +++ D LVD+ +PGDRV+VTGI   + ++   P +R  +++F  Y
Sbjct: 194 RPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGI---LDIKQDSPVKRGSRAVFDIY 250
Query: 385 IDCLHIKKADKSRMLVEDAMEIDNSHPRIEDEIQFDESKIQQLKELSRQPNIYETLTRSL 444
           +    I+ + K                 + DE+   E   +++K+L++ P I + +  S+
Sbjct: 251 MKVSSIEVSQK-----------------VLDEVIISEEDEKKIKDLAKDPWIRDRIISSI 293
Query: 445 APNIWELDDVKKGLLCQLFGGNALKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSP 504
           AP+I+   ++K+ L   LFGG   K+      RGDI+IL++GDPGT+KSQ+LQ+I +++P
Sbjct: 294 APSIYGHWELKEALALALFGG-VPKVLEDTRIRGDIHILIIGDPGTAKSQMLQFISRVAP 352
Query: 505 RGIYTSGKGSSAVGLTAYVTKDPETGETVLESGALVLSDRGICCIDEFDKMSESARSMLH 564
           R +YT+GKGS+A GLTA V ++  TGE  LE+GALVL+D GI  IDE DKM +  R  +H
Sbjct: 353 RAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDEDRVAIH 412
Query: 565 EVMEQQTVSIAKAGIIASLNARTSVLACANPSGSRYNPRLSVIENIHLPPTLLSRFDLIY 624
           E MEQQTVSIAKAGI+A LNAR +V+A  NP   RY     V +NI+LPPT+LSRFDLI+
Sbjct: 413 EAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYISERPVSDNINLPPTILSRFDLIF 472
Query: 625 LILDKADEQTDRRLAKHIVSLHFENPENSEQGVLDLATLTAYVSYARKHIHPKLSDEAAE 684
           ++ D+  EQ DR LA +I+ +H      S + ++D+ TL  Y++YARK++ PK++ EA  
Sbjct: 473 ILKDQPGEQ-DRELANYILDVH---SGKSTKNIIDIDTLRKYIAYARKYVTPKITSEAKN 528
Query: 685 ELTRGYVEMRRRGNFPGSSKKVITATPRQIESLIRLSEALARIRLSELVEKHDVEEAFRL 744
            +T  +VEMR++ +    S   I  TPRQ+E+LIR+SEA A++ L   V + D E A  +
Sbjct: 529 LITDFFVEMRKKSSETPDSP--ILITPRQLEALIRISEAYAKMALKAEVTREDAERAINI 586
Query: 745 LEVAMQ 750
           + + ++
Sbjct: 587 MRLFLE 592
>pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 Back     alignment and structure
>pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 Back     alignment and structure
>pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 806
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 3e-54
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-16
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-08
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-04
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score =  185 bits (471), Expect = 3e-54
 Identities = 62/237 (26%), Positives = 104/237 (43%), Gaps = 11/237 (4%)

Query: 154 EIYKEGKYMRAINRVLEIEGEW--IDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMD 211
           E +    Y   +   +E       I+VD  D+  +D DL + ++  P +V+      + +
Sbjct: 12  EFFSLQDYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRN 71

Query: 212 IVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFR 271
           I  L        + +R   + +   +R L    I K V++ G+V +   I P I +A+F 
Sbjct: 72  IDRLRK---NVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFE 128

Query: 272 CLVCGYYSDPIVVDRGRINEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIP 331
           C  C  +   +      I EPS C         S  L+ +   F D Q ++LQE  +++ 
Sbjct: 129 CRGCMRHH-AVTQSTNMITEPSLC---SECGGRSFRLLQDESEFLDTQTLKLQEPLENLS 184

Query: 332 DGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVRVGPTQRTVKSLFKTYIDCL 388
            G  P  +++++ D LVD   PGD V VTG  R   VR   T+R    ++  Y + L
Sbjct: 185 GGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRT--VRDERTKRFKNFIYGNYTEFL 239
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query806
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 100.0
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 100.0
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.78
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.69
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.68
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.56
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.56
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.55
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.51
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.47
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.47
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.46
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.44
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.4
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.4
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.38
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.38
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.3
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.24
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.2
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.19
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.14
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.9
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.85
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.83
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.7
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.61
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.55
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.38
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.25
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.47
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.36
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.87
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.64
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.54
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.44
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.16
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.14
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.07
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.04
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.78
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.57
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.14
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.99
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.62
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.36
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.25
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.18
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.18
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.13
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.0
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.61
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.59
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.41
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.32
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.27
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.17
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.91
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.84
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.78
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.43
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.37
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.04
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.82
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.73
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.68
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.45
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.39
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.13
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.03
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.91
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.64
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 89.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.37
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.26
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 88.77
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 88.7
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.59
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.56
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.51
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.5
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.35
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.73
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.64
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.56
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.54
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.53
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.45
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 87.42
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.3
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.26
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.14
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.93
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 86.68
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 86.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.6
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.39
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.35
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.29
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.23
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.2
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.09
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 86.07
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.06
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 85.99
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 85.92
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 85.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.61
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.58
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.56
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.51
d1nrjb_209 Signal recognition particle receptor beta-subunit 85.49
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 85.39
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.95
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.87
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 84.87
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 84.63
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 84.62
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.57
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.51
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.45
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 84.45
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.42
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 84.37
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.36
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 84.32
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 84.19
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.18
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.06
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 83.76
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 83.72
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.66
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 83.24
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 83.09
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.04
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 82.99
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.79
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 82.47
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.1
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 81.89
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 81.57
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 81.3
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 81.28
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 81.11
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.01
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=100.00  E-value=2.4e-44  Score=328.55  Aligned_cols=232  Identities=26%  Similarity=0.438  Sum_probs=202.7

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCCEEEEECHHHHCCCHHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             9999999753100000058842210011499999999870--79499993303611287999999869799999999999
Q 003637          132 SAIQMFLKHFREKEELLSGSESEIYKEGKYMRAINRVLEI--EGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVL  209 (806)
Q Consensus       132 ~~f~~FL~~F~~~~~~~~~~~~~~~~~~~Y~~~i~~~~~~--~~~~l~Id~~dL~~fd~~La~~l~~~P~~~l~~~~~ai  209 (806)
                      +.+..|.+.|..               ..|.++|.+++..  +..+|.|||.||..|+|+|+.+|+++|.+++++|+.|+
T Consensus         5 ~~l~~f~e~~~~---------------~~y~~~i~~~~~~~~~~~sl~Vd~~~L~~~~~~L~~~l~~~P~~~l~~~~~ai   69 (239)
T d1ltla_           5 KTLTKFEEFFSL---------------QDYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAI   69 (239)
T ss_dssp             HHHHHHHHHTTS---------------HHHHHHHHHHHHHTTSCCEEEEEHHHHHHHCTTHHHHHHHSHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCH---------------HHHHHHHHHHHHCCCCCCEEEEEHHHHHHHCHHHHHHHHHCHHHHHHHHHHHH
T ss_conf             999999998362---------------76899999999718987099997999874699999999989899999999998


Q ss_pred             HHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCEEECCCCC
Q ss_conf             99999627656772899994168855777889358793699998999725663057878998234576678647517865
Q 003637          210 MDIVSLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMVIRCSSIIPEIREAIFRCLVCGYYSDPIVVDRGRI  289 (806)
Q Consensus       210 ~e~~~~~~~~~~~~i~vr~~nl~~~~~iR~L~~~~igkLV~i~GiV~r~S~v~p~l~~a~f~C~~C~~~~~~~~~~~~~~  289 (806)
                      +++...   .....+++|+.|+|...++|+|++.++||||+|+|+|+|+|.|+|+++.++|.|..|++... +.++.+.+
T Consensus        70 ~~~~~~---~~~~~i~vr~~~~~~~~~ir~l~s~~igkLv~v~GiV~r~s~v~~~~~~~~~~C~~C~~~~~-~~~~~~~~  145 (239)
T d1ltla_          70 RNIDRL---RKNVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHA-VTQSTNMI  145 (239)
T ss_dssp             TTTCTT---CCCCCCEEEEECCSCBCCGGGCCGGGTTSEEEEEEEEEEECCCEEEEEEEEEEETTTCCEEE-EECSSSSC
T ss_pred             HHHHHH---CCCCEEEEEECCCCCCCCHHCCCHHHHCCEEEEEEEEEEECCEEEEEEEEEEECCCCCCEEE-EEECCCEE
T ss_conf             767752---35734999980798765620035001103999989999937777799999999888885699-97169715


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEEC
Q ss_conf             69866686223899942673164210003689985189999999997299999444433567999889999999953202
Q 003637          290 NEPSTCLKQECLAKNSMTLVHNRCRFADKQIVRLQETPDDIPDGGTPHTVSLLMHDKLVDAGKPGDRVEVTGIYRAMSVR  369 (806)
Q Consensus       290 ~~P~~C~~~~C~~~~~~~l~~~~s~f~d~Q~IkiQE~p~~~p~G~~Prsi~V~l~~dLvd~~~pGd~V~VtGIl~~~~~~  369 (806)
                      .+|..|++  |+++ +|.++.+.|.|+|||+|+|||.|+++|.|++||+++|+|++||||+++|||+|.|+|||++.+..
T Consensus       146 ~~p~~C~~--C~~~-~f~~~~~~s~~~d~Q~i~iQE~~e~~~~G~~Pr~i~v~l~~dlvd~~~pGd~V~i~GI~~~~~~~  222 (239)
T d1ltla_         146 TEPSLCSE--CGGR-SFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRTVRDE  222 (239)
T ss_dssp             CCCSCCTT--TCCC-CEEECGGGCEEEEEEEEEEECCSTTCCSSCCCCEEEEEEEGGGTTCCCTTCEEEEEEEEEEEEET
T ss_pred             CCCCCCCC--CCCC-CCEECCCCCEEEEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCCCCCEEEEEEEEEEEECC
T ss_conf             37755777--7996-51871374337662899974042447889999679999960302865899999999999876569


Q ss_pred             CCCCCCCCCCEEEEEEEEEEEEE
Q ss_conf             38874444420468899987897
Q 003637          370 VGPTQRTVKSLFKTYIDCLHIKK  392 (806)
Q Consensus       370 ~~~~~~~~~~~~~~yi~a~~i~~  392 (806)
                             ....++.||.|++|+.
T Consensus       223 -------~~~~~~~~i~a~~Ie~  238 (239)
T d1ltla_         223 -------RTKRFKNFIYGNYTEF  238 (239)
T ss_dssp             -------TTTEEEEEEEEEECCB
T ss_pred             -------CCCCEEEEEEEEEEEE
T ss_conf             -------9983279999999997
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure