Citrus Sinensis ID: 003743


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------80
MVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQFLTELDGVEVLTGVFVFAATSRPDLLDAALLRPGRLDRLLFCDFPSPRERLDILKVISRKLPLADDVDLEAIAHMTEGFSGADLQALLSDAQLSAVHEILNNIDSNEPGKMPVITDALLKSIASKARPSVSEAEKLRLYSIYGQFLDSKKSVAAQSRDAKGKRATLA
cccccccHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccEEEcccEEEEEEECcccccccccccccccccccccHHcccccccEEEEEccccccccccccccHHHHHHHHccccccHHHHHHHcccccccccccCEEcccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHHHHHHHcccEEEEECccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEECccccHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccc
**S*S**********KAFGIGL**************************LSAEDDIIA***************YQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELT***************QLFGKLNSG****************FDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSI***************VIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKR**DNTGVTDRVVNQFLTELDGVEVLTGVFVFAATSRPDLLDAALLRPGRLDRLLFCDFPSPRERLDILKVISRKLPLADDVDLEAIAHMTEGFSGADLQALLSDAQLSAVHEILNNI********PVITDALLKSIAS**********KLRLYSIYGQFL*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQFLTELDGVEVLTGVFVFAATSRPDLLDAALLRPGRLDRLLFCDFPSPRERLDILKVISRKLPLADDVDLEAIAHMTEGFSGADLQALLSDAQLSAVHEILNNIDSNEPGKMPVITDALLKSIASKARPSVSEAEKLRLYSIYGQFLDSKKSVAAQSRDAKGKRATLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis protein 1 Involved in PTS1- and PTS2-dependent protein import into peroxisomes. May form heteromeric AAA ATPase complexes required for the import of proteins.probableQ9FNP1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X8A, chain A
Confidence level:very confident
Coverage over the Query: 511-732,744-762
View the alignment between query and template
View the model in PyMOL
Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 215-498
View the alignment between query and template
View the model in PyMOL