Citrus Sinensis ID: 003791

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-----
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
cHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEEcccEEEEEEEcccccccEEEEEccccEEEEEEccccccccEEEcccccccccEEEEEccEEEEEEccccEEEEEEcccccEEEEEEccccccccccEEccccEEEEccEEEEEEcccEEEEEEcccccEEEEEEccccccEEEEEEEEcccccEEEEEEcccccEEEEEEEccccccccccccccccccccEEEEEEccEEEEEEccccEEEEEEccccEEEEEEEEcccccccccccEEEEccccccEEEEEEcccEEEEEEEccccEEEEEEEccccEEEEEEEEcccccEEEEEEEcccEEEEEEccccccccccEEEEEEEccccccEEEEEEEEEEcccccccEEEEEEEEccEEEEEEccEEEEEEcccccccEEEEEEEcccccccccHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccccccEEEEEEEEcccEEEEEEcccccEEEEEEccccccccccccEEEEEEEEccccccccccEEEEEEEEcccccccEEEEEEEccccEEEcccccccccEEEEEEccccccccEEEEEEEccccEEEcccccHHHHHHHccccccEEEEEEccccEEEEEEEEEccccccccccEEEEEEEEEEEEcccccEEEEEEEcccccEEEEcEEEEcccEEEEEcccccEEEEEEEccccccccccccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEcEEEEEEEEccccEEEEEEEEEEcccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccEEEEccccccccEEEEEEcccEEEEEccccccEEEEEEEcccccccccEcccccEEEEEEccccEEEEEEccccEEEEEEEcccccccccEEEcccccEEcccccEEEEcccEEEEEEcccccEEEEEEcccccccEEEEEEEccccEEEEEEEcccccEEEEEEEcccccEEccEcccccccccccEEEccccEEEEEcccccEEEEEEEEcccEEEEEccccHccccccccccccccccccEEEEEccccEEEEEEcccccEEEEEEcccHHHHHccccccccccEEEEEEEcccEEEEEEEccccccccccccEEccccccccccEEEEEEEEccccccEEEEEEEEccccEEEEEccEEEEEcHHHHHHHHHEEEEccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccccccccccccccEEEEEEEcccEEEEEEccccEEEEEEEccccccccccccEEEEEEEEccccccccccEEEEEEcccccccccEEEEEEEcccccEEccccccccEEEEEEEEcccccccEEEEEEcccccEEEccccHHHHHHHHHHcccEEEEEEEccccEEEEEEEEcccccccccccccEEEEEEEEEccccccEEEEEEccccccccccccEEccccHEHHHEccccEEEEEEEccccccccccccccccEEEEEEEEccccEEEEEEEcccccccEEEEEEccEEEEEEEccccccEEEEEEEEEccccEEcc
MAIRFIILTLLFlssctipslslyeDQVGLMDWHQQYIGKVKHAVFHtqktgrkrVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITlssdgstlrawnlpdgqmvWESFlrgskhskplllvptnlkvdkdslilVSSKgclhavssidgeilwtrDFAAESVEVQQVIqldesdqiYVVGYAGSSQFHAYQINAMNgellnhetaafsggfvGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHlsnlgedssgmveilpssltgmFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEhggskvditvkpgqdwnnNLVQESIEMDHQRGLVHKVFINNylrtdrshGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDvttselpvekegVSVAKVEHSLFEWLKGHMLKLKgtlmlaspEDVAAIQAIRLKSsekskmtrdhNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHkseacdsptelnlyqwqtphhhamdenpsvlvvgrcgvsskapaiLSFVdtytgkelnsfDLVHSAvqvmplpftdsteQRLHLlvdddrrihlypktsEAISIFQQEFSNIYWYSVeadngiikghavkskcagevldDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVAtvapkasghigsadpdEAWLVVYLIDTITGRILHrmthhgaqgpvhavLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFhtqktgrkrvvvstEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSIlvtvsfknrkIAFQEthlsnlgedssGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHggskvditvkpgqDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDvttselpvekegVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRlkssekskmtrdhngfRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVsrkqnevvhtqakvtseqdVMYKYISKNLLFVATVAPKASGhigsadpdEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
**IRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIR*************NGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYD*******
*AIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGI*D**DGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPV*************LFEWLKGHMLKLKGTLMLASPEDVA*******************NGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKE*N***L**SAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSK****V**DFCFETRVLWSIIFPMESEKI************HTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSR****
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIR******SKMTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKAS******DPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVTTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAVCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query795 2.2.26 [Sep-21-2011]
Q5ZL00 983 ER membrane protein compl yes no 0.910 0.736 0.264 4e-64
Q8N766 993 ER membrane protein compl yes no 0.916 0.734 0.269 7e-63
Q5R7K6 996 ER membrane protein compl yes no 0.919 0.733 0.268 8e-61
Q6NRB9 987 ER membrane protein compl N/A no 0.913 0.735 0.253 8e-60
Q8C7X2 997 ER membrane protein compl yes no 0.901 0.719 0.262 4e-59
O13981 885 ER membrane protein compl yes no 0.158 0.142 0.291 1e-08
>sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 Back     alignment and function desciption
 Score =  246 bits (629), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 219/829 (26%), Positives = 379/829 (45%), Gaps = 105/829 (12%)

Query: 23  LYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHV-- 80
           +YEDQVG  DW QQY+GK+K A     + G K+++V TE+NV+A+L+ R GEI WRH   
Sbjct: 16  VYEDQVGKFDWRQQYVGKLKFASLEAAQ-GSKKLLVGTEKNVVAALNSRSGEILWRHADK 74

Query: 81  LGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFL-RGSKHSKPLLLVPTN 139
                 +D + I  G+  IT+SS G  LR+W    G + WE+ L  GS  +  L+ +   
Sbjct: 75  ATPEGAIDAMLIH-GQDAITVSSAGRILRSWETNIGGLNWETSLDTGSFQTASLVGLQDA 133

Query: 140 LKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGS 199
           +K      +L  +   LH +S  +G   W            Q++    +  I+V+G    
Sbjct: 134 VKY---VAVLKKAAISLHYLS--NGHQKWVEHLPESENTQYQMLYSRGAGVIHVLGVVPQ 188

Query: 200 SQFHAYQINAMNGELLNHETAAF--------SGGFVGDVALVSSDT------LVTLDTTR 245
           S      ++  +GE++     A         + G VG+  LV +DT      + +L+T +
Sbjct: 189 SHLKVLTLSVEDGEVIEQTKVAAPWLKSLNGACGVVGEAVLVCADTATHSLYVCSLETEQ 248

Query: 246 SIL----------VTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYK 295
            +               F+ R +A Q + ++     +   +++ P    G F++      
Sbjct: 249 EMKQIPLQSLDLEFADGFQPRVLATQPSVIN--ASRTQFFLQLSP----GHFSLLQCKQG 302

Query: 296 LFIRLTSEDKLEVVH--KVDHETVVSDALVFSEGKEAFAVVEHGGS-----KVDITVKPG 348
           L   L    +  +V       +TV +     +E K A +   HG +     K +      
Sbjct: 303 LLSHLRDFQQAALVSFATTGEKTVAAVLTCRNELKPASSDGLHGNALEDSQKQEALTCSN 362

Query: 349 QDWNNNL-----------VQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSL 397
           Q +N NL              +  ++       +++I  +L+ D S G+RAL+  EDH L
Sbjct: 363 QTYNINLYLVETGQRLLDTTITFNLEQNGAKPEQLYIQVFLKKDDSVGYRALVQTEDHML 422

Query: 398 LLVQQ-GKIVWNREDALASIIDVTTSELPV-----EKEGVSVAKVEHSLFEWLKGHMLKL 451
           + +QQ GK+VW+RE++LA ++ +   +LP+     E EG    K +  L  +LK    +L
Sbjct: 423 MFLQQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLK----RL 478

Query: 452 KGTLMLASPEDV----AAIQAIRLKSSEKSK-----MTRDHNGFRKLLIVLTKARKIFAL 502
              L+L              A + +S  K++     + RD    +K+++++T + K+F +
Sbjct: 479 SSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGI 538

Query: 503 HSGDGRVVWSLLLHKSEACDSPTELNLYQWQTPHHHAMDENPSVLVVGRCGVSSKAPAIL 562
            S  G ++W   L       S   L L   +T  H       ++LV  +    +K   + 
Sbjct: 539 ESSSGTILWKQYLRNVRPGAS---LKLMVQRTTAHFPHPPQCTLLVKDK---ETKMSFLY 592

Query: 563 SFVDTYTGK-ELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIF 621
            F   +  + ++    L    +Q + LP  D    ++ LL+DD+ ++  +P T   +   
Sbjct: 593 VFNPIFGKRSQVAPPVLKRPVLQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQL 652

Query: 622 QQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVS 681
           ++   +I++Y V+A+ G + G  +K              T   W +  P E ++I+    
Sbjct: 653 EEMAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWQVAIPTEVQRIVTVKG 702

Query: 682 RKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAPKASGHIGSADP--DEAWLVVYLID 739
           ++ +E VH+Q +V  ++ V+YK ++ NLL V T          S D   +  ++ +YLID
Sbjct: 703 KRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT---------ESTDTHHERTFVGIYLID 753

Query: 740 TITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYD 788
            +TGRI+H      A+GPVH V SENWVVY Y+N +A R E +V E+Y+
Sbjct: 754 GVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYE 802

Gallus gallus (taxid: 9031)
>sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 Back     alignment and function description
>sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 Back     alignment and function description
>sp|O13981|EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emc1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query795
255551016 983 catalytic, putative [Ricinus communis] g 0.994 0.804 0.735 0.0
225429981 987 PREDICTED: uncharacterized protein KIAA0 0.996 0.802 0.729 0.0
224089040 985 predicted protein [Populus trichocarpa] 0.976 0.787 0.715 0.0
356507901 983 PREDICTED: uncharacterized protein KIAA0 0.969 0.784 0.694 0.0
356515591 983 PREDICTED: uncharacterized protein KIAA0 0.964 0.780 0.690 0.0
224141767775 predicted protein [Populus trichocarpa] 0.955 0.980 0.706 0.0
145357905 982 PQQ_DH domain-containing protein [Arabid 0.993 0.804 0.659 0.0
449513201 985 PREDICTED: ER membrane protein complex s 0.968 0.781 0.659 0.0
449465135 985 PREDICTED: ER membrane protein complex s 0.968 0.781 0.660 0.0
297811273 982 hypothetical protein ARALYDRAFT_487993 [ 0.993 0.804 0.655 0.0
>gi|255551016|ref|XP_002516556.1| catalytic, putative [Ricinus communis] gi|223544376|gb|EEF45897.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1221 bits (3160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/795 (73%), Positives = 676/795 (85%), Gaps = 4/795 (0%)

Query: 1   MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVST 60
           MAIR + L  L L S  IP+ SLYEDQVGLMDWHQ+YIGKVK AVFHTQKTGRKRV+VST
Sbjct: 1   MAIR-VFLFSLLLLSTAIPTFSLYEDQVGLMDWHQRYIGKVKDAVFHTQKTGRKRVIVST 59

Query: 61  EENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVW 120
           EENVIASLDLRHGEIFWRHV G ND +DGIDIA+GKYVITLSS+G  LRAWNLPDGQMVW
Sbjct: 60  EENVIASLDLRHGEIFWRHVFGTNDAIDGIDIAMGKYVITLSSEGGILRAWNLPDGQMVW 119

Query: 121 ESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQ 180
           ESFL+G   SK LLLVP + KVDKD+ ILV  KGCL A+SSI GEI+W +DFAAES EVQ
Sbjct: 120 ESFLQGLNPSKSLLLVPASFKVDKDNTILVFGKGCLSAISSIHGEIIWKKDFAAESFEVQ 179

Query: 181 QVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVT 240
           QVIQ   SD IYVVG+ GSSQF AYQINA NGELL HE+AA SGGF G+V+LVS++TLV 
Sbjct: 180 QVIQPPSSDIIYVVGFVGSSQFDAYQINAKNGELLKHESAALSGGFSGEVSLVSTNTLVV 239

Query: 241 LDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRL 300
           LD+T S L  VSF+N +I+FQ+T++S+L  D  GM  I+PS L G+F +K +++ +FIR+
Sbjct: 240 LDSTGSALTAVSFQNGEISFQKTYISDLIADPMGMAMIIPSKLIGVFALKTHSFMIFIRV 299

Query: 301 TSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESI 360
           T E  LEV+ K+ H T VSD+L   E  +AFA+VEH G  + +TVK   +WN +L++ESI
Sbjct: 300 TDEGNLEVIDKIKHVTAVSDSLSLLEDWQAFAIVEHRGEDIYLTVKLSHNWNGDLLKESI 359

Query: 361 EMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVT 420
           +MDHQRG+VHKVFINNY+RTDR+HGFRALIVMEDHSLLL+QQG+IVW+RED LASIIDVT
Sbjct: 360 KMDHQRGIVHKVFINNYIRTDRTHGFRALIVMEDHSLLLLQQGEIVWSREDGLASIIDVT 419

Query: 421 TSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMT 480
           TSELPVEKEGVSVAKVE +LFEWLKGH+LKLKGTLMLASPEDV AIQA+RLKSSEKSKMT
Sbjct: 420 TSELPVEKEGVSVAKVEQNLFEWLKGHILKLKGTLMLASPEDVVAIQAMRLKSSEKSKMT 479

Query: 481 RDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLL---LHKSEACDSPTELNLYQWQTPHH 537
           RDHNGFRKLLI LTK+ K+FALH+GDGRVVWS+    L KS+AC++PT +N+YQWQ PHH
Sbjct: 480 RDHNGFRKLLIALTKSGKVFALHTGDGRVVWSVFMNSLRKSDACENPTGVNMYQWQVPHH 539

Query: 538 HAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQR 597
           HAMDENPSVLVVGRC  SS A  +LSF+DTYTGKEL+S  L HS VQV+PL FTDSTEQR
Sbjct: 540 HAMDENPSVLVVGRCRPSSDALGVLSFIDTYTGKELSSSSLAHSVVQVIPLTFTDSTEQR 599

Query: 598 LHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDF 657
           LHLL+D D++ HLYPKT EA+ IFQ+EFSNI+WYSVEAD+GII+GHA+K  C GEV D++
Sbjct: 600 LHLLIDADQKAHLYPKTPEAVGIFQREFSNIFWYSVEADSGIIRGHALKGNCIGEVADEY 659

Query: 658 CFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAP 717
           CFET+ +WSI+FP+ESEKII  V+RK NEVVHTQAKV ++QDVMYKYISKNLLFV TV P
Sbjct: 660 CFETKRIWSILFPLESEKIITTVTRKANEVVHTQAKVIADQDVMYKYISKNLLFVVTVTP 719

Query: 718 KASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAH 777
           KA G IG+A P+E+WLV YLIDT+TGRILHRMTHHGA GPVHAV SENWVVYHYFNLRAH
Sbjct: 720 KAIGGIGTATPEESWLVAYLIDTVTGRILHRMTHHGANGPVHAVFSENWVVYHYFNLRAH 779

Query: 778 RYEMSVTEIYDQSRA 792
           RYEMSV EIYDQSRA
Sbjct: 780 RYEMSVIEIYDQSRA 794

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429981|ref|XP_002284012.1| PREDICTED: uncharacterized protein KIAA0090 homolog [Vitis vinifera] gi|296081867|emb|CBI20872.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224089040|ref|XP_002308610.1| predicted protein [Populus trichocarpa] gi|222854586|gb|EEE92133.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356507901|ref|XP_003522701.1| PREDICTED: uncharacterized protein KIAA0090 homolog [Glycine max] Back     alignment and taxonomy information
>gi|356515591|ref|XP_003526482.1| PREDICTED: uncharacterized protein KIAA0090 homolog [Glycine max] Back     alignment and taxonomy information
>gi|224141767|ref|XP_002324236.1| predicted protein [Populus trichocarpa] gi|222865670|gb|EEF02801.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|145357905|ref|NP_196717.3| PQQ_DH domain-containing protein [Arabidopsis thaliana] gi|332004312|gb|AED91695.1| PQQ_DH domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449513201|ref|XP_004164260.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465135|ref|XP_004150284.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297811273|ref|XP_002873520.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. lyrata] gi|297319357|gb|EFH49779.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query795
TAIR|locus:2144266 982 AT5G11560 "AT5G11560" [Arabido 0.993 0.804 0.659 2.3e-291
ZFIN|ZDB-GENE-060810-98 964 emc1 "ER membrane protein comp 0.855 0.705 0.260 4e-73
UNIPROTKB|F1NZP8 983 EMC1 "ER membrane protein comp 0.441 0.357 0.255 3.1e-46
UNIPROTKB|Q5ZL00 983 EMC1 "ER membrane protein comp 0.441 0.357 0.255 3.1e-46
UNIPROTKB|Q8N766 993 EMC1 "ER membrane protein comp 0.444 0.355 0.262 5.1e-46
UNIPROTKB|F1SUQ3893 EMC1 "Uncharacterized protein" 0.436 0.388 0.260 7.3e-45
UNIPROTKB|I3LHU9896 EMC1 "Uncharacterized protein" 0.436 0.387 0.263 9.5e-45
UNIPROTKB|Q5R7K6 996 EMC1 "ER membrane protein comp 0.413 0.330 0.272 1e-44
RGD|1310427 993 Emc1 "ER membrane protein comp 0.427 0.342 0.263 1.6e-44
UNIPROTKB|J9P2M7 1007 EMC1 "Uncharacterized protein" 0.437 0.345 0.262 2e-44
TAIR|locus:2144266 AT5G11560 "AT5G11560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2798 (990.0 bits), Expect = 2.3e-291, P = 2.3e-291
 Identities = 524/795 (65%), Positives = 650/795 (81%)

Query:     1 MAIRFIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVST 60
             MAIR  +  LLFLSS  + S SLYEDQ GL DWHQ+YIGKVKHAVFHTQKTGRKRV+VST
Sbjct:     1 MAIRVFLTLLLFLSSAIL-SFSLYEDQAGLTDWHQRYIGKVKHAVFHTQKTGRKRVIVST 59

Query:    61 EENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVW 120
             EENV+ASLDLRHGEIFWRHVLG  D +DG+ IALGKYVITLSS+GSTLRAWNLPDGQMVW
Sbjct:    60 EENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVW 119

Query:   121 ESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQ 180
             E+ L  ++HSK LL VP NLKVDKD  I V   G LHAVS+IDGE+LW +DF AE  EVQ
Sbjct:   120 ETSLHTAQHSKSLLSVPINLKVDKDYPITVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQ 179

Query:   181 QVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVT 240
             +V+Q   S  IYV+G+  SS+   YQI++ +GE++  ++  F GGF G+++ VSSD +V 
Sbjct:   180 RVLQAPGSSIIYVLGFLHSSEAVVYQIDSKSGEVVAQKSTVFPGGFSGEISSVSSDKVVV 239

Query:   241 LDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIRL 300
             LD+TRSILVT+ F +  I+FQ+T +S+L EDS G  EIL   L+ M  VK+N   +F+ +
Sbjct:   240 LDSTRSILVTIGFIDGDISFQKTPISDLVEDS-GTAEILSPLLSNMLAVKVNKRTIFVNV 298

Query:   301 TSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQESI 360
               + KLEVV  +  ET +SD+L  ++ +EAFA V H GS++ + VK   D NN L++E+I
Sbjct:   299 GDKGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSRIHLMVKLVNDLNNVLLRETI 358

Query:   361 EMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDVT 420
             +MD  RG VHKVF+NNY+RTDRS+GFRALIVMEDHSLLL+QQG IVW+RE+ LAS+ DVT
Sbjct:   359 QMDQNRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT 418

Query:   421 TSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKMT 480
             T+ELP+EK+GVSVAKVEH+LFEWLKGH+LKLKG+L+LASPEDV AIQ +R+KSS K+K+T
Sbjct:   419 TAELPLEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQDLRVKSSGKNKLT 478

Query:   481 RDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLH---KSEACDSPTELNLYQWQTPHH 537
             RDHNGFRKL++ LT+A K+FALH+GDGR+VWS+LL+   +S++C+ P  ++LYQWQ PHH
Sbjct:   479 RDHNGFRKLILALTRAGKLFALHTGDGRIVWSMLLNSPSQSQSCERPNGVSLYQWQVPHH 538

Query:   538 HAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQR 597
             HAMDENPSVLVVG+CG  S AP +LSFVD YTGKE++S D+ HS VQVMPLP TDS EQR
Sbjct:   539 HAMDENPSVLVVGKCGSDSSAPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPITDSKEQR 598

Query:   598 LHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDDF 657
             LHL+ D    +HLYPKTSEA+SIFQ+EF N+YWY+VEAD+GII+GH +K  C+GE  D++
Sbjct:   599 LHLIADTVGHVHLYPKTSEALSIFQREFQNVYWYTVEADDGIIRGHVMKGSCSGETADEY 658

Query:   658 CFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVAP 717
             CF TR LW+++FP ESEKII+ ++RK NEVVHTQAKV ++QD++YKY+S+NLLFVATV+P
Sbjct:   659 CFTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSP 718

Query:   718 KASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAH 777
             K +G IGS  P+E+ LVVYLIDTITGRILHR++H G QGPVHAV SENWVVYHYFNLRAH
Sbjct:   719 KGAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAH 778

Query:   778 RYEMSVTEIYDQSRA 792
             +YE++V EIYDQSRA
Sbjct:   779 KYEVTVVEIYDQSRA 793
GO:0003824 "catalytic activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0005773 "vacuole" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
ZFIN|ZDB-GENE-060810-98 emc1 "ER membrane protein complex subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZP8 EMC1 "ER membrane protein complex subunit 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL00 EMC1 "ER membrane protein complex subunit 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N766 EMC1 "ER membrane protein complex subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUQ3 EMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LHU9 EMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7K6 EMC1 "ER membrane protein complex subunit 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1310427 Emc1 "ER membrane protein complex subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2M7 EMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032451001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (987 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query795
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 6e-08
COG1520370 COG1520, COG1520, FOG: WD40-like repeat [Function 7e-07
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 9e-07
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 5e-06
pfam07774 217 pfam07774, DUF1620, Protein of unknown function (D 3e-05
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 5e-05
COG1520370 COG1520, COG1520, FOG: WD40-like repeat [Function 1e-04
cd00216434 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases 9e-04
cd10276358 cd10276, BamB_YfgL, Beta-barrel assembly machinery 0.001
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 0.003
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information 
 Score = 53.9 bits (130), Expect = 6e-08
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 26/150 (17%)

Query: 104 DGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSID 163
               + A +   G+++W   L G+     +        VD   L + + KG L A+ +  
Sbjct: 1   ADGVVAALDAATGKVLWRVDLGGTALGGGVA-------VDGGRLYVATGKGELVALDAAT 53

Query: 164 GEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELL-----NHE 218
           G++LW +D + E +    V        + VV   GS     Y ++A  G+LL     +  
Sbjct: 54  GKLLWRKDLSGEILGAPTVAG----GVVVVVTADGS----LYALDAETGKLLWSYQRSLP 105

Query: 219 TAAFSGG----FVGDVALV--SSDTLVTLD 242
                G      VGD  +V  SS  LV LD
Sbjct: 106 PLTLRGSSSPAIVGDTVIVGFSSGKLVALD 135

This domain contains several repeats of the PQQ repeat. Length = 234
>gnl|CDD|224437 COG1520, COG1520, FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|219566 pfam07774, DUF1620, Protein of unknown function (DUF1620) Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|224437 COG1520, COG1520, FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>gnl|CDD|199833 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases and related proteins Back     alignment and domain information
>gnl|CDD|199834 cd10276, BamB_YfgL, Beta-barrel assembly machinery (Bam) complex component B and related proteins Back     alignment and domain information
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 795
KOG2103 910 consensus Uncharacterized conserved protein [Funct 100.0
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.83
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.76
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.73
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.71
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.64
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.63
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.6
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 99.5
COG1520370 FOG: WD40-like repeat [Function unknown] 99.49
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 99.49
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 99.32
COG1520370 FOG: WD40-like repeat [Function unknown] 99.29
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 99.26
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 99.01
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.76
COG4993773 Gcd Glucose dehydrogenase [Carbohydrate transport 98.64
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.89
COG4993773 Gcd Glucose dehydrogenase [Carbohydrate transport 97.83
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.68
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 97.61
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.55
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.49
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.37
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.32
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.31
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.15
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.13
PTZ00421493 coronin; Provisional 97.03
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 96.98
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.9
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 96.85
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 96.82
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 96.57
KOG0296399 consensus Angio-associated migratory cell protein 96.51
KOG2103910 consensus Uncharacterized conserved protein [Funct 96.5
PTZ00420568 coronin; Provisional 96.45
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 96.33
KOG2055514 consensus WD40 repeat protein [General function pr 95.98
KOG0318603 consensus WD40 repeat stress protein/actin interac 95.96
KOG1539910 consensus WD repeat protein [General function pred 95.95
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 95.91
KOG0316307 consensus Conserved WD40 repeat-containing protein 95.6
KOG2048691 consensus WD40 repeat protein [General function pr 95.55
PRK11028330 6-phosphogluconolactonase; Provisional 95.43
KOG0316307 consensus Conserved WD40 repeat-containing protein 95.19
KOG0291893 consensus WD40-repeat-containing subunit of the 18 95.17
KOG0296399 consensus Angio-associated migratory cell protein 95.06
PTZ00421493 coronin; Provisional 95.01
KOG0278334 consensus Serine/threonine kinase receptor-associa 94.83
PLN029191057 haloacid dehalogenase-like hydrolase family protei 94.66
PLN00181793 protein SPA1-RELATED; Provisional 94.63
PHA02713557 hypothetical protein; Provisional 94.63
KOG2048691 consensus WD40 repeat protein [General function pr 94.44
KOG0319775 consensus WD40-repeat-containing subunit of the 18 94.42
KOG0291893 consensus WD40-repeat-containing subunit of the 18 94.3
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 93.79
PHA03098534 kelch-like protein; Provisional 93.62
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.59
KOG0310487 consensus Conserved WD40 repeat-containing protein 93.48
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 93.43
KOG0315311 consensus G-protein beta subunit-like protein (con 92.9
PHA02790480 Kelch-like protein; Provisional 92.85
KOG0266456 consensus WD40 repeat-containing protein [General 92.55
PRK11028330 6-phosphogluconolactonase; Provisional 92.52
KOG3881412 consensus Uncharacterized conserved protein [Funct 92.43
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.33
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 92.29
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.14
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 91.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 91.91
PLN00181793 protein SPA1-RELATED; Provisional 91.64
KOG1539910 consensus WD repeat protein [General function pred 91.43
PTZ00420568 coronin; Provisional 91.26
PRK05137435 tolB translocation protein TolB; Provisional 91.16
KOG14451012 consensus Tumor-specific antigen (contains WD repe 91.11
PLN029191057 haloacid dehalogenase-like hydrolase family protei 90.93
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 90.61
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 90.37
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.2
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.01
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 89.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 89.84
PHA02713557 hypothetical protein; Provisional 88.99
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 88.87
COG3823262 Glutamine cyclotransferase [Posttranslational modi 88.38
PRK03629429 tolB translocation protein TolB; Provisional 88.35
KOG0270463 consensus WD40 repeat-containing protein [Function 88.26
KOG0266456 consensus WD40 repeat-containing protein [General 88.1
KOG0275508 consensus Conserved WD40 repeat-containing protein 88.07
PRK04922433 tolB translocation protein TolB; Provisional 88.0
PRK04792448 tolB translocation protein TolB; Provisional 87.95
KOG0649325 consensus WD40 repeat protein [General function pr 87.37
PHA02790480 Kelch-like protein; Provisional 87.35
KOG0303472 consensus Actin-binding protein Coronin, contains 86.92
KOG1274 933 consensus WD40 repeat protein [General function pr 86.28
KOG4547541 consensus WD40 repeat-containing protein [General 85.42
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 85.25
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 84.65
KOG0286343 consensus G-protein beta subunit [General function 84.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 83.63
KOG0310487 consensus Conserved WD40 repeat-containing protein 83.58
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 83.58
PRK00178430 tolB translocation protein TolB; Provisional 83.53
KOG0282503 consensus mRNA splicing factor [Function unknown] 82.24
KOG0315311 consensus G-protein beta subunit-like protein (con 82.14
KOG0293519 consensus WD40 repeat-containing protein [Function 81.37
KOG0649325 consensus WD40 repeat protein [General function pr 80.75
KOG2321703 consensus WD40 repeat protein [General function pr 80.22
>KOG2103 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-114  Score=968.50  Aligned_cols=705  Identities=34%  Similarity=0.482  Sum_probs=553.4

Q ss_pred             HhcccCccceeeccccceeEEEeccCceeeeeeeeeccCCCEEEEEeCCCEEEEEECcCCccceEEEcCCcceeeeeeee
Q 003791           14 SSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIA   93 (795)
Q Consensus        14 ~~~~~~~~Al~edq~G~~dW~~~~vG~~~~~~f~~~~~~~~~v~vat~~g~l~ALn~~tG~ivWR~~l~~~~~i~~l~~~   93 (795)
                      +++..+|+|+||||+|++|||++++| ++...|+.-.+..+++||+|++|+||+||.+||++.|||.++.+....+... 
T Consensus         9 ~~~~~~~aav~edq~gkfdwr~~~vG-~~k~~~~~~~t~~~rlivsT~~~vlAsL~~~tGei~WRqvl~~~~~~~~~~~-   86 (910)
T KOG2103|consen    9 ALLLYRAAAVYEDQAGKFDWRQQLVG-VKKVNFLVYDTKSKRLIVSTEKGVLASLNLRTGEIIWRQVLEPKTSGLGVPL-   86 (910)
T ss_pred             HHHHHHHHHHHHHHhhhcchhhhccc-ceeEEEEeecCCCceEEEEeccchhheecccCCcEEEEEeccCCCcccCcce-
Confidence            33335667999999999999999999 5555566666678999999999999999999999999999998844333211 


Q ss_pred             eCCEEEEEEccCCeEEEEeCCCCcEeEEEeccCccccCCceeccccccccCCCeEEEEeCCEEEEEECCCCcEEEEEecc
Q 003791           94 LGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFA  173 (795)
Q Consensus        94 ~g~~~V~Vs~~g~~v~A~d~~tG~llWe~~~~~~~~s~~~~~~~~~~~~~~~~~V~V~~~g~l~ald~~tG~~~W~~~~~  173 (795)
                       -   -++|.+|..+|+||.++|.+.|+..+..+ . +...+..       ...+.|+.+     .....|+.+|.+..+
T Consensus        87 -~---~~iS~dg~~lr~wn~~~g~l~~~i~l~~g-~-~~~~~~v-------~~~i~v~~g-----~~~~~g~l~w~~~~~  148 (910)
T KOG2103|consen   87 -T---NTISVDGRYLRSWNTNNGILDWEIELADG-F-KGLLLEV-------NKGIAVLNG-----HTRKFGELKWVESFS  148 (910)
T ss_pred             -e---EEEccCCcEEEeecCCCceeeeecccccc-c-ceeEEEE-------ccceEEEcc-----eeccccceeehhhcc
Confidence             1   15788899999999999999999999876 3 2222221       222333333     667889999999887


Q ss_pred             CcceeeeeEEEEecCCEEEEEEecCCceeEEEEEEcCCCcee-eeeeeeccCCcccceEEecCcEEEEEECCCCeEEEEE
Q 003791          174 AESVEVQQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELL-NHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVS  252 (795)
Q Consensus       174 ~~~~~~~~vv~s~~~~~Vyvv~~~g~~~~~v~ald~~tG~~~-w~~~v~~~~~~~~~~~~vg~~~lv~~d~~~~~L~v~~  252 (795)
                      .......|.+.+...+.+|++++--.++..|.+++..+|... |+.++..|+.-...|.-+.+-+++|.+   |.+...|
T Consensus       149 ~~~~~~~q~~~~~~t~vvy~~~~l~~s~~~V~~~~~~~g~v~~~~~~v~~pw~~~~~c~~~k~~vl~~s~---g~l~s~d  225 (910)
T KOG2103|consen  149 ISIEEDLQDAKIYGTDVVYVLGLLKRSGSCVQQVFSDDGEVTGPQSTVLGPWFKVLSCSTDKEVVLVCSN---GTLISLD  225 (910)
T ss_pred             ccchhHHHHhhhccCcEEEEEEEEecCCceEEEEEccCCcEecceeeeecCcccccccccccceEEEcCC---CCeEEEE
Confidence            655444554445678889999987666678999999999999 777777786544456555556788885   4788888


Q ss_pred             eecCeeeeEEEeecccCCCCCCceEEeecCCcc-eeEEEecCcEEEEEEecCCcEEEEEeecCcceeeeeeeecCCceEE
Q 003791          253 FKNRKIAFQETHLSNLGEDSSGMVEILPSSLTG-MFTVKINNYKLFIRLTSEDKLEVVHKVDHETVVSDALVFSEGKEAF  331 (795)
Q Consensus       253 l~sg~~~~~~~~l~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~v~~~~~~~~~~s~~~~~~~~~~~~  331 (795)
                      +..++....+...           +++-. +.| ...+..++|..++.+++.|...++......-..+.+++..++..++
T Consensus       226 i~~~~~~~~q~~~-----------e~l~~-l~g~~i~~~g~~~~~~V~V~s~~~~~v~~~~~~e~~lsdsl~~~~d~e~~  293 (910)
T KOG2103|consen  226 ISSQKVQISQLLA-----------EILLP-LTGDLILLDGNKHTAMVSVNSSSNHWVYLFCRSEVDLSDSLEAGGDTEAS  293 (910)
T ss_pred             EEeeccchhhhhh-----------hhhhc-cCCceEEecCCCceeEEEEecCCCeEEEeecccceeeccccccccccccc
Confidence            8876521111111           11110 111 3444555577888988777766654433222334444455566666


Q ss_pred             EEEEecCceEEEEEeeeeeeecCccceeeeeccCCceeeEEEEEEEEecCCCceEEEEEEEcCCcEEEEECCeEE-EEec
Q 003791          332 AVVEHGGSKVDITVKPGQDWNNNLVQESIEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIV-WNRE  410 (795)
Q Consensus       332 ~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~r~l~~t~d~~~~l~~~g~~~-WtRe  410 (795)
                      .++.+..+.....++-++.......+....++...+.|+.+..  +..++++.+||++++++|+.+.+.|||.+. |+||
T Consensus       294 ~si~~~ss~~~~~V~~vn~l~~~~~~~~~~~~~~l~~p~~F~~--~~~~~~e~~~~al~~~~d~~~~~~qng~i~~WsRE  371 (910)
T KOG2103|consen  294 KSIHPESSYLFDQVFIVNNLYLVLDAQSILLEQKLSRPEVFGT--FEYFDREIGALALVVNDDHSLLFLQNGLILVWSRE  371 (910)
T ss_pred             eeeecccchhhheeeehhhhhhcchhhhhhhhcccCcchhcce--eEEeccccceEEEEEecCceEEEEeCcceEEeehh
Confidence            6655554321111221221111112223344455566644332  444555669999999999999999998877 9999


Q ss_pred             cccccceeEEEEeCCCCcccchhhhhhhhhh----hhHHHHHH-hhhhccccCChhhHHHHhh-------cc-ccccccc
Q 003791          411 DALASIIDVTTSELPVEKEGVSVAKVEHSLF----EWLKGHML-KLKGTLMLASPEDVAAIQA-------IR-LKSSEKS  477 (795)
Q Consensus       411 EsLa~i~~~~~vdlp~~~~~~~~~~le~e~~----~~~~~~~~-Rl~~~~~~~~~~~~~~l~~-------~~-~~~~~~~  477 (795)
                      |+||++++++|+|||++++   ++.+|.||.    +++++||+ |+.+        |+.+|++       .+ ++++.++
T Consensus       372 EsLa~vvd~~~vdlpLs~~---~~~~e~e~~~~~~~~l~~afl~R~~t--------q~~ql~~~~~h~~~~~~~~s~~~n  440 (910)
T KOG2103|consen  372 ESLANVVDVEMVDLPLSRD---QGLLEDEFEDKESNSLWGAFLKRLTT--------QFNQLINLLKHNQGLPTPLSALKN  440 (910)
T ss_pred             hhhhhhccceeeccccccc---hhhHHHHhhccccchHHHHHHHHHHH--------HHHHHHHHHHhhhccCCCcccccc
Confidence            9999999999999999998   667777763    36999999 9999        8888766       22 4455566


Q ss_pred             c-ccccCCCceEEEEEEecCceEEEEECCCCcEEEEEecccCCCCCCCceee-EEeeecCcccCCCCCCeEEEEEEeCCC
Q 003791          478 K-MTRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLLLHKSEACDSPTELN-LYQWQTPHHHAMDENPSVLVVGRCGVS  555 (795)
Q Consensus       478 ~-~~rD~FGf~Klivv~T~~Gkl~alds~~G~i~W~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~vv~~~~~~  555 (795)
                      + +.||.||||||||++|++|||||||+.+|+++|++.+++...  +++.++ ++|+..+|||   +++.|.|+++++  
T Consensus       441 ~~l~rD~Fgl~K~iIvlT~tGkiFglds~~G~i~Wkl~L~~~~~--~~e~v~l~vqr~~~H~~---~d~~~svlf~~k--  513 (910)
T KOG2103|consen  441 KDLSRDKFGLRKMIIVLTSTGKIFGLDSVDGQIHWKLWLPNVQQ--NPEGVKLFVQRTTAHFP---LDEDPSVLFVHK--  513 (910)
T ss_pred             cceeecccCceeEEEEEecCceEEEEEcCCCeEEEEEecCcccC--CcccceEEEEeccccCC---CCCCCeEEEEec--
Confidence            6 999999999999999999999999999999999999997432  456899 7899999998   788888888886  


Q ss_pred             CCCCcEEEEEEccCCceecccccccceeEEEeecccCCccceEEEEEcCCCceEEccCChhhhhhhhhcccceEEEEEEc
Q 003791          556 SKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQRLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEA  635 (795)
Q Consensus       556 ~~~~~~~~~~n~~tG~~~~~~~l~~~~~~~~~lp~~~~~~~~~~~l~d~~~~v~~~P~~~~~~~~~~~~~~~~~~~~~d~  635 (795)
                      .++++++|.|||++|++.++.+++++++|.++||.++.++++.++++|+.+.+++||.+.+.+..++++++++|+|++|.
T Consensus       514 ~s~~gvly~fn~~~Gkv~s~~~l~~~v~q~sllp~~~~d~~~~illidd~~~v~l~P~~~~~l~~~~~~a~s~y~Yt~e~  593 (910)
T KOG2103|consen  514 GSGNGVLYEFNPITGKVISRSPLDYRVKQLSLLPVTEHDHQYLILLIDDHLKVKLYPGTSTDLEIVANEASSIYLYTVEA  593 (910)
T ss_pred             cCCCeEEEEEecCcceeeecCccCCceeeEEeccccccccceeEEEecccceEEecCCCcccchhhhhccCccEEEEEEc
Confidence            58899999999999999998889999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCeEEEEEEeecCCCcccccccceeeEeEEEEcCCCCceEEEEeeccCCcccccceeeecCCeeEeeccCCceEEEEEE
Q 003791          636 DNGIIKGHAVKSKCAGEVLDDFCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATV  715 (795)
Q Consensus       636 ~~~~l~G~~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~e~Iv~~~~r~~~e~v~S~g~VLgDRsVLYKYLNPNL~~v~t~  715 (795)
                      ++|.|+||.++.+          ++..++|+.++|++.|+||++..|+++|+|||+|||||||+||||||||||+||+|.
T Consensus       594 ~~~~i~Gy~i~~~----------lT~~~~W~~~l~~e~e~IIav~~r~p~e~VhSqGrVlgdrsVlYKYlnPNL~A~~t~  663 (910)
T KOG2103|consen  594 DTGGIYGYIIKAD----------LTTTQTWKKNLPSEKEKIIAVKGRNPNEHVHSQGRVLGDRSVLYKYLNPNLAAVATA  663 (910)
T ss_pred             ccCcEEEEEEecc----------cceeeeeeeccCchhheeeEeccCCcchheeecceecccceeeeeccCcchhheeec
Confidence            9999999999844          578899999999777999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCCcEEEEEEEEceeeeEEEEEEeCCCCCCceEEEEecEEEEEEEeCCcceEEEEEEEEccCcccc
Q 003791          716 APKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRAHRYEMSVTEIYDQSRAV  793 (795)
Q Consensus       716 ~~~~~~~~g~~~~~~~~l~vyLiD~VTG~il~s~~h~~~~~pv~~v~~ENWvvYsy~~~~~~~~~i~vvELyE~~~~~  793 (795)
                      ++++       +++   .++||||+|||+|+|+++|+++++|||+||||||+||||||++.+|+|++|+|||||+++.
T Consensus       664 ~~~~-------~~~---~~~~LiD~VTG~Ivht~~h~k~~~PvhiVfSENWvvYsYfs~k~~rteltvvELYEgs~~~  731 (910)
T KOG2103|consen  664 NPDD-------HHE---TFLYLIDTVTGSIVHTQSHQKARGPVHIVFSENWVVYSYFSDKARRTELTVVELYEGSEQD  731 (910)
T ss_pred             CcCC-------cee---EEEEEEeeeeeEEEEeeehhhhcCceEEEEecceEEEEEeccccccceEEEEEEecCCccc
Confidence            9983       221   1569999999999999999999999999999999999999999999999999999998753

>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2103 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query795
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 8e-11
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 2e-10
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 2e-10
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 1e-09
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 1e-07
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 4e-09
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 4e-08
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 1e-07
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
 Score = 63.7 bits (155), Expect = 8e-11
 Identities = 26/146 (17%), Positives = 56/146 (38%), Gaps = 17/146 (11%)

Query: 55  RVVVSTEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLP 114
            V        + +LDLR G+I W+  LG    V+   +  G  +  +  +   + A  + 
Sbjct: 241 VVFALAYNGNLTALDLRSGQIMWKRELG---SVNDFIVD-GNRIYLVDQND-RVMALTID 295

Query: 115 DGQMVWESF-LRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFA 173
            G  +W    L     + P+        +   +L++  S+G LH ++  DG  +  +   
Sbjct: 296 GGVTLWTQSDLLHRLLTSPV--------LYNGNLVVGDSEGYLHWINVEDGRFVAQQKVD 347

Query: 174 AESVEVQQVIQLDESDQIYVVGYAGS 199
           +   + + V       ++ +    G+
Sbjct: 348 SSGFQTEPVA---ADGKLLIQAKDGT 370
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Length = 369 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Length = 369 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query795
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.76
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.68
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.58
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.56
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.56
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.56
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.55
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.54
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.47
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.44
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.44
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.41
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.4
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.38
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.32
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.32
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 99.3
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.16
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 99.05
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.04
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.96
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.92
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.73
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.61
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.57
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.57
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.48
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.44
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.4
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.35
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.28
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.23
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.22
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.2
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.17
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.16
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.11
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.1
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.09
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.07
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.04
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.02
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.0
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.99
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.97
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.94
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.94
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.92
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.89
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.88
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.85
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.85
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.84
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.83
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.83
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.8
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.79
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.79
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.77
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.77
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.75
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.75
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.72
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.72
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.66
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.65
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.62
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.6
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.58
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.57
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.56
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.56
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.55
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.51
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.47
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.44
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.42
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.42
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.41
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.39
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.38
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.38
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.37
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.36
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.36
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.35
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.34
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.34
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.33
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.33
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.31
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.21
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.18
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.18
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.14
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.13
3jrp_A379 Fusion protein of protein transport protein SEC13 97.12
3hx6_A570 Type 4 fimbrial biogenesis protein PILY1; beta pro 97.09
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.07
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.06
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.06
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.05
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.04
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.04
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.03
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.99
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.98
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.98
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.93
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.9
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.9
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.87
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.83
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.81
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.8
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.79
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.78
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.76
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.74
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.71
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.7
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.67
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.66
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.66
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.64
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.61
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.56
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.5
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.48
3hx6_A570 Type 4 fimbrial biogenesis protein PILY1; beta pro 96.43
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.41
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.4
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.36
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.31
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.22
3jrp_A379 Fusion protein of protein transport protein SEC13 96.21
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.2
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.16
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.15
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.15
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.06
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.03
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.03
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.02
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.98
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.93
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.88
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.84
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.8
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.78
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.76
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.69
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.66
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.64
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.64
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.6
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.6
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.49
3jro_A753 Fusion protein of protein transport protein SEC13 95.46
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.45
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 95.34
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.28
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.14
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.14
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.08
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.02
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.0
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 94.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.93
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.89
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.78
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.77
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 94.77
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.73
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.73
2zux_A591 YESW protein; beta-propeller, lyase, rhamnose comp 94.63
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.62
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 94.6
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.6
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.59
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 94.58
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.57
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 94.56
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.49
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.38
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.36
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.35
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.26
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 94.22
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.19
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 93.87
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.87
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.65
3jro_A753 Fusion protein of protein transport protein SEC13 93.6
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 93.57
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 93.52
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.52
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.39
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 93.32
4a2l_A795 BT_4663, two-component system sensor histidine kin 93.07
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.98
2qe8_A343 Uncharacterized protein; structural genomics, join 92.97
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 92.93
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 92.89
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.72
3v9f_A781 Two-component system sensor histidine kinase/RESP 92.7
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.55
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 92.54
2zuy_A620 YESX protein; beta-propeller, lyase; 1.65A {Bacill 92.1
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 91.94
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.89
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.84
2fp8_A322 Strictosidine synthase; six bladed beta propeller 91.79
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 91.72
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.58
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 91.54
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.33
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.09
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.06
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.98
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 90.95
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 90.52
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 90.36
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.17
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.91
2pm7_B297 Protein transport protein SEC13, protein transport 89.88
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 89.88
2ece_A462 462AA long hypothetical selenium-binding protein; 89.72
2qe8_A343 Uncharacterized protein; structural genomics, join 89.71
3elq_A571 Arylsulfate sulfotransferase; beta propeller, prot 89.58
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 89.53
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 89.48
3elq_A571 Arylsulfate sulfotransferase; beta propeller, prot 89.26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 89.21
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.15
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 88.91
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 87.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 87.95
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.53
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 86.49
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 85.67
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.67
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 85.61
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 85.51
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.31
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 85.26
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.9
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 84.78
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 84.21
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 84.07
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.2
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 81.77
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 81.47
3ott_A758 Two-component system sensor histidine kinase; beta 81.29
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 81.06
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 81.05
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 80.86
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 80.49
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 80.49
2ece_A462 462AA long hypothetical selenium-binding protein; 80.08
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
Probab=99.76  E-value=6e-16  Score=169.85  Aligned_cols=216  Identities=17%  Similarity=0.296  Sum_probs=147.7

Q ss_pred             eccccceeEEEeccCceeee-eeeeeccCCCEEEEEeCCCEEEEEECcCCccceEEEcCCc--------ceeeeeeeeeC
Q 003791           25 EDQVGLMDWHQQYIGKVKHA-VFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGIN--------DVVDGIDIALG   95 (795)
Q Consensus        25 edq~G~~dW~~~~vG~~~~~-~f~~~~~~~~~v~vat~~g~l~ALn~~tG~ivWR~~l~~~--------~~i~~l~~~~g   95 (795)
                      .+..++..|+.++-+..... ....|...+++||+++.++.|+|+|++||+++|++.+...        ..+... +...
T Consensus        24 ~~~~~~~~W~~~~~~~~~~~~~~~~p~v~~~~v~~~~~~g~v~a~d~~tG~~~W~~~~~~~~~~~~~~~~~~~~~-~~~~  102 (376)
T 3q7m_A           24 NQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGG-VTVS  102 (376)
T ss_dssp             CSSCCEEEEEECCTTTTTTSCCCCCCEEETTEEEEECTTSEEEEEETTTCCEEEEEECCC---CCSCCCCCEEEE-EEEE
T ss_pred             CCCcceEEeEEecCCCccccceeeccEEECCEEEEEcCCCeEEEEEccCCceeeeecCccccccccccCcccccC-ceEe
Confidence            34567899999873221111 1124555689999999999999999999999999998642        112222 3455


Q ss_pred             CEEEEEEccCCeEEEEeCCCCcEeEEEeccCccccCCceeccccccccCCCeEEEE-eCCEEEEEECCCCcEEEEEeccC
Q 003791           96 KYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVS-SKGCLHAVSSIDGEILWTRDFAA  174 (795)
Q Consensus        96 ~~~V~Vs~~g~~v~A~d~~tG~llWe~~~~~~~~s~~~~~~~~~~~~~~~~~V~V~-~~g~l~ald~~tG~~~W~~~~~~  174 (795)
                      ++.+++++.++.|+++|+.||+++|+..+.....  ..+.+      . ++.|++. .++.|+++|++||+++|++..+.
T Consensus       103 ~~~v~v~~~~g~l~a~d~~tG~~~W~~~~~~~~~--~~p~~------~-~~~v~v~~~~g~l~~~d~~tG~~~W~~~~~~  173 (376)
T 3q7m_A          103 GGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEAL--SRPVV------S-DGLVLIHTSNGQLQALNEADGAVKWTVNLDM  173 (376)
T ss_dssp             TTEEEEEETTSEEEEEETTTCCEEEEEECSSCCC--SCCEE------E-TTEEEEECTTSEEEEEETTTCCEEEEEECCC
T ss_pred             CCEEEEEcCCCEEEEEECCCCCEEEEEeCCCceE--cCCEE------E-CCEEEEEcCCCeEEEEECCCCcEEEEEeCCC
Confidence            6677777666799999999999999999876543  11222      2 5677776 48999999999999999998765


Q ss_pred             cceee---eeEEEEecCCEEEEEEecCCceeEEEEEEcCCCceeeeeeeeccCC---------cccceEEecCcEEEEEE
Q 003791          175 ESVEV---QQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGG---------FVGDVALVSSDTLVTLD  242 (795)
Q Consensus       175 ~~~~~---~~vv~s~~~~~Vyvv~~~g~~~~~v~ald~~tG~~~w~~~v~~~~~---------~~~~~~~vg~~~lv~~d  242 (795)
                      +....   ...  ...++.+|+.+..|    .++++|+.||+.+|+.....+.+         +...+++.+ +.+++..
T Consensus       174 ~~~~~~~~~~~--~~~~~~v~~g~~~g----~l~~~d~~tG~~~w~~~~~~~~~~~~~~~~~~~~~~p~~~~-~~v~~~~  246 (376)
T 3q7m_A          174 PSLSLRGESAP--TTAFGAAVVGGDNG----RVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVN-GVVFALA  246 (376)
T ss_dssp             -----CCCCCC--EEETTEEEECCTTT----EEEEEETTTCCEEEEEECCC-----------CCCCCCEEET-TEEEEEC
T ss_pred             CceeecCCCCc--EEECCEEEEEcCCC----EEEEEECCCCcEEEEEecccCCCCcccccccccCCCcEEEC-CEEEEEe
Confidence            43200   111  23578888744344    79999999999999997655432         233444444 4443333


Q ss_pred             CCCCeEEEEEeecCee
Q 003791          243 TTRSILVTVSFKNRKI  258 (795)
Q Consensus       243 ~~~~~L~v~~l~sg~~  258 (795)
                       ..+.++++|..+|+.
T Consensus       247 -~~g~l~~~d~~tG~~  261 (376)
T 3q7m_A          247 -YNGNLTALDLRSGQI  261 (376)
T ss_dssp             -TTSCEEEEETTTCCE
T ss_pred             -cCcEEEEEECCCCcE
Confidence             467899999998873
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hx6_A Type 4 fimbrial biogenesis protein PILY1; beta propeller, pilus protein, cell adhesion; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hx6_A Type 4 fimbrial biogenesis protein PILY1; beta propeller, pilus protein, cell adhesion; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2zux_A YESW protein; beta-propeller, lyase, rhamnose complex; HET: RAM; 1.32A {Bacillus subtilis} PDB: 2z8s_A* 2z8r_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2zuy_A YESX protein; beta-propeller, lyase; 1.65A {Bacillus subtilis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3elq_A Arylsulfate sulfotransferase; beta propeller, protein-substrate complex, periplasm, transesterification, phenol, bacteria; 2.00A {Escherichia coli} PDB: 3ett_A* 3ets_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3elq_A Arylsulfate sulfotransferase; beta propeller, protein-substrate complex, periplasm, transesterification, phenol, bacteria; 2.00A {Escherichia coli} PDB: 3ett_A* 3ets_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query795
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.35
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 99.34
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 99.33
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.28
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 99.25
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 99.22
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 99.13
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.11
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.04
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.31
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.09
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.05
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.04
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.02
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.77
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.55
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.53
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.39
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.36
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.33
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.32
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.26
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.22
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.21
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.11
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.73
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.69
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.54
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.52
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.47
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.41
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.19
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.1
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.08
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.06
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.05
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 95.79
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 95.53
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 95.2
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.98
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.71
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.53
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.46
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.24
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.06
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.48
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.29
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.25
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.89
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 92.88
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.48
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 91.19
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.12
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 89.83
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 88.79
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 88.08
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 87.91
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 87.03
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 86.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 84.9
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 82.74
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 82.0
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: Quinoprotein alcohol dehydrogenase-like
family: Quinoprotein alcohol dehydrogenase-like
domain: Quinoprotein alcohol dehydrogenase, N-terminal domain
species: Pseudomonas putida, hk5 [TaxId: 303]

Probab=99.35  E-value=1.7e-11  Score=140.10  Aligned_cols=221  Identities=15%  Similarity=0.202  Sum_probs=132.0

Q ss_pred             ceeEEEeccCceeeeeeeeeccCCCEEEEEeCCCEEEEEECcCCccceEEEcCCcce---ee-----eeeeeeCCEEEEE
Q 003791           30 LMDWHQQYIGKVKHAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHVLGINDV---VD-----GIDIALGKYVITL  101 (795)
Q Consensus        30 ~~dW~~~~vG~~~~~~f~~~~~~~~~v~vat~~g~l~ALn~~tG~ivWR~~l~~~~~---i~-----~l~~~~g~~~V~V  101 (795)
                      ++.|++++ |... ....+|...+++||+.|.+|.|+|||++||+++||+..+....   ..     .-.+...++.|++
T Consensus        45 ~~aW~~~~-~~~~-~~~stPiv~~g~vyv~t~~~~v~AlDa~tG~~lW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~  122 (560)
T d1kv9a2          45 GLAWYMDL-DNTR-GLEATPLFHDGVIYTSMSWSRVIAVDAASGKELWRYDPEVAKVKARTSCCDAVNRGVALWGDKVYV  122 (560)
T ss_dssp             EEEEEEEC-SCCS-CCCCCCEEETTEEEEEEGGGEEEEEETTTCCEEEEECCCCCGGGGGGCTTCSCCCCCEEEBTEEEE
T ss_pred             eEEEEEEC-CCCC-CcEeCCEEECCEEEEECCCCeEEEEeCCCCCEEEEECCCCCccccccccccccccCcceeCCeEEE
Confidence            36798876 3221 1123455568999999999999999999999999986543210   00     0011233445666


Q ss_pred             EccCCeEEEEeCCCCcEeEEEeccCccccCCceeccccccccCCCeEEEEe-------CCEEEEEECCCCcEEEEEeccC
Q 003791          102 SSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDKDSLILVSS-------KGCLHAVSSIDGEILWTRDFAA  174 (795)
Q Consensus       102 s~~g~~v~A~d~~tG~llWe~~~~~~~~s~~~~~~~~~~~~~~~~~V~V~~-------~g~l~ald~~tG~~~W~~~~~~  174 (795)
                      ...++.|+|+|+.||+++|+.....+.........+   .+. ++.|++..       .|.|+|||+.||+++|++....
T Consensus       123 ~~~~g~l~Alda~tG~~~w~~~~~~~~~~~~~~~~p---~v~-~~~vivg~~~~~~~~~G~v~a~D~~TG~~~W~~~t~~  198 (560)
T d1kv9a2         123 GTLDGRLIALDAKTGKAIWSQQTTDPAKPYSITGAP---RVV-KGKVIIGNGGAEYGVRGFVSAYDADTGKLAWRFYTVP  198 (560)
T ss_dssp             ECTTSEEEEEETTTCCEEEEEECSCTTSSCBCCSCC---EEE-TTEEEECCBCTTTCCBCEEEEEETTTCCEEEEEESSC
T ss_pred             EeCCCEEEEEECCCCcEEeccCccCcccceeeeeee---eee-cCcccccccceeccccceEEEEECCCceEEeeeeecc
Confidence            666789999999999999999876543210000111   122 56666642       4789999999999999997531


Q ss_pred             cce-----------------------------eeeeEEEEecCCEEEEEEecC------------C---ceeEEEEEEcC
Q 003791          175 ESV-----------------------------EVQQVIQLDESDQIYVVGYAG------------S---SQFHAYQINAM  210 (795)
Q Consensus       175 ~~~-----------------------------~~~~vv~s~~~~~Vyvv~~~g------------~---~~~~v~ald~~  210 (795)
                      +.-                             ....+..-...+.+|+..-..            +   +.-.+.|||++
T Consensus       199 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~W~~~s~D~~~~l~y~~tgn~~~~~~~~~~~~~g~n~~s~sivAld~~  278 (560)
T d1kv9a2         199 GDPALPYEHPELREAAKTWQGDQYWKLGGGGTVWDSMAYDPELDLLYVGTGNGSPWNREVRSPGGGDNLYLSSILAIRPD  278 (560)
T ss_dssp             CCTTSCCSSHHHHHHHTTCCSSCHHHHCEECCCCSCEEEETTTTEEEEECCCEESSCHHHHSTTCCCCTTTTEEEEECTT
T ss_pred             ccccCCccccccccccccccccccccccCCCCcccccccccccCeeeecCCCCcccccccccccCCccccceeeEEecCC
Confidence            100                             000011112455666533210            0   12368999999


Q ss_pred             CCceeeeeeeecc--CCcc--cceEEe----cC---cEEEEEECCCCeEEEEEeecCe
Q 003791          211 NGELLNHETAAFS--GGFV--GDVALV----SS---DTLVTLDTTRSILVTVSFKNRK  257 (795)
Q Consensus       211 tG~~~w~~~v~~~--~~~~--~~~~~v----g~---~~lv~~d~~~~~L~v~~l~sg~  257 (795)
                      ||+++|.++....  +...  ..+.++    .+   ..+++.+ .+|.++++|-.+|+
T Consensus       279 tG~~~W~~Q~~~~D~wd~d~~~~~~l~~~~~~g~~~~~v~~~~-k~G~~~~lDr~tG~  335 (560)
T d1kv9a2         279 TGKLAWHYQVTPGDSWDFTATQQITLAELNIDGKPRKVLMQAP-KNGFFYVLDRTNGK  335 (560)
T ss_dssp             TCCEEEEEESSTTCCSCCCCCSCEEEEEEEETTEEEEEEEECC-TTSEEEEEETTTCC
T ss_pred             ccceeEEEeccccccccccccceeeeeeeecCCceeeeeeecC-ccceEEEEecCCCc
Confidence            9999998864332  2211  122221    11   1333333 45777788877776
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure