Citrus Sinensis ID: 003810


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790----
MSTEENSVIVMPESGIEDSLKSEKQLSDTNGGSNGNLVMHNGMRDEHGSSNDNNEQLLGLVMELKLQNEFLKSQFEGLNTLRPEDDGQESREVVDVKELRERIESLSKELQEEKETRGAAEKALEHLRVQYEEADAKAQEFSAKLAEAQQKLGQEIKGHEDKYTELDSKFTRLHKRAKQRIQEVQKEKDDLETRLRDVGETAERASSQCSALQQELERTRQQANDALKAMDIERQQLRSANNKLRDNIEELCRSFQPKEDALEALQLSLQEKDQMLEDMRTLLQAAEEKRQASIAELSAKHQKNLESLEAQLADAVSDRSKATETISSLQVLVAEKETTIAEMEAASTGKEARFKAAVETVKGELAHLKREHEKEKESWEAASQAFRKKLEIAESNCIHTEIEAAKLRSQLESELSVQNQLLSTRDAELMAAKQEIIHLEREFSSYKIRAHALLQKKDAELVAANDTEQLRALEEALKETEKEMSLVSAEKDKALQELQEALANHDKELAERDAALNNANQQIKSIEIKLDSMNTKLQVEKEAWEKNLQTVEESWRLRCELLKAQKEESSGQDVQKELQELKLQYKRLKDEHDSFRDLADRMMEEKDNEISRLLDDNKNLHRSLELRPADNHNDKDSTGITASQKQDVLNSIPSAAEQQILLLARQQAQREEELAQSQRHILALQEELEELERENRLHSQQEAMLKEEFRNMERSKKREGVDMTYLKNVILKLLETGEVEALLPVIAMLLQFSPEEMQKCQRAYLASTDVPPSTTPANDSSGTTLSLFSRFSFS
cccccccHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccccccc
*********************************************************LGLVMELKLQNEFL********************************************************************************************************************************************************************************************************************************************************************************************************************************IAESNCIHTEI**************************LMAAKQEIIHLEREFSSYKIRAHALLQKK************************************************************************************EAWEKNLQTVEESWRLRCELL**************************************************************************************************************************************************************VDMTYLKNVILKLLETGEVEALLPVIAMLLQFSPEEMQ***************************SLFSRFSFS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTEENSVIVMPESGIEDSLKSEKQLSDTNGGSNGNLVMHNGMRDEHGSSNDNxxxxxxxxxxxxxxxxxxxxxFEGLNTLRPEDDGQESRExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGQEIKGHEDKYTELDSKFTRLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFQPKEDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLxxxxxxxxxxxxxxxxxxxxxxxxxxxxISSLQVLVAEKETTIAEMEAASTGKEARFKAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCIHTEIEAAKLRSQLESELSVQNQLLSTRDAExxxxxxxxxxxxxxxxxxxxxAHALLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWRLRCELLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLELRPADNHNDKDSTGITASQKQDVLNSIPSAAEQQILLLARQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFRNMERSKKREGVDMTYLKNVILKLLETGEVEALLPVIAMLLQFSPEEMQKCQRAYLASTDVPPSTTPANDSSGTTLSLFSRFSFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein GRIP Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.probableQ8S2T0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 164-192
View the alignment between query and template
View the model in PyMOL
Template: 1UPT, chain B
Confidence level:confident
Coverage over the Query: 719-765
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 193-307
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 99-228
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 298-380
View the alignment between query and template
View the model in PyMOL
Template: 3BBP, chain D
Confidence level:probable
Coverage over the Query: 679-716
View the alignment between query and template
View the model in PyMOL
Template: 1X79, chain B
Confidence level:probable
Coverage over the Query: 540-609
View the alignment between query and template
View the model in PyMOL
Template: 3TNU, chain B
Confidence level:probable
Coverage over the Query: 512-553
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 126-639
View the alignment between query and template
View the model in PyMOL