Citrus Sinensis ID: 003821

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790---
MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVRNYTSRQDASEGNITSSGRSIWSKMIGFAKYIYARRERKFPARASALDQNPDVDKRSSSKMECGSPSDTPDDTPDGSISC
ccccccEEEEEccccHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHccccccccccccHHHHHHHHccccccEEccEEEEcccccccccEEEEEEEcccEEEEEEEcccccccEEcccccccccccccccccccEEEEEccccccccccccccccccccEEEEcccccccccEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEccccccccccEEEEcccccEEEEcccEEcEEEEEEEccccccccEEEccccHHHHHHHHHHHHHEEEEEEEEEccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccHHHHHHcccccEEccccHHHHHHHHHcccccccccccccHHHHHHHHccccEEEEEEcHHHHHHHHHHccccEEEEccccccccEEEEEcccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEEcccccHHHHHHHHHHHcccccEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEcccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccEccccEEEEEccccccccccEEEEEEccccEEEEEEEcccccEEEEccccccccccccccccccccccEEEEccccEcccEEEEcccccEEEEEEcccccccHEEEEccccccccccEEEEHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEEEEcEEEEEccccHHHccEEEEEEcccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHcccccEEEccHHHHHHHHHHccccEEEEcccEccccEEEEcccccccHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
MIKEKEVKVIVGMETWGAATMVADigsraqvpvlsfaepaiappltstrwpFLVRMANSSAEQITCTAALVGSYNWRKVIIIYeddatnadtgNLALLSEALQIsnseieyrlvlppisyltdpkQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKemglvgpdsVWVIASDTITSALgikthfsqdsssykIFEDQFRSYfrseypeddvsepgiyalRAYDSITVVAKSidgmtsdnssskislgyilssnftglsgpisfrggkllnspILRIINMVGKKykeidfwlpkfglsktlkmeedknsskvgdirngligaviwpgdlkrdpkgramptdakpliigvparttFDKFVKLIssdnphkiiydGYCIELFYKVLQVLKydlpyefsdydaaigdITILVNRtrfvefsqpytesglsmvvpakaeqspwifikpftwgmwIVTGAILIYTMSVVWFLEhrwnpefngpwniqIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTvqrlkpnvtdigwlkasnlnvgfdgdSFVRNYLEnvlgfkpenilkvdheykYITDFESNRIAAAFLELSYERAFLSQHCKEytatiptyrfggfafvfqkgsplaaDFSEAILKLSengelrsleekwfapspecsgsaevnnnkteclSLQDFWGLFLISGTTSTICALVFLVRNytsrqdasegnitssGRSIWSKMIGFAKYIYARRERkfparasaldqnpdvdkrssskmecgspsdtpddtpdgsisc
MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGikthfsqdsssyKIFEDQFRSYFRSeypeddvsePGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEdknsskvgdirngligaviwpgdlkrdpKGRAMptdakpliigvpartTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLgfkpenilkVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVRNYtsrqdasegnitssgrsiwSKMIGFAKYIYARRERKFparasaldqnpdvdkrssskmecgspsdtpddtpdgsisc
MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPkqflqekllkllRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNltrlvvvvwlfvvlilNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVRNYTSRQDASEGNITSSGRSIWSKMIGFAKYIYARRERKFPARASALDQNPDVDKRSSSKMECgspsdtpddtpdgsISC
******VKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDG********KISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTL**********VGDIRNGLIGAVIWPGDL************AKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLS***********WF***************KTECLSLQDFWGLFLISGTTSTICALVFLVRNYTS************GRSIWSKMIGFAKYIYARR********************************************
MI*EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIA*****TRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSK*****************NGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFK****************FESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFA***********************FWGLFLISGTTSTICALVFLVRNYTSRQ****************KMIGFA***************************************************
MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVRNYTSR*********SSGRSIWSKMIGFAKYIYARRERKFPARASALD********************************
***EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKME********GDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPE*************CLSLQDFWGLFLISGTTSTICALVFLVRNYTSRQDAS******S*****SKMIGFAKYIYA**********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEFSDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVRNYTSRQDASEGNITSSGRSIWSKMIGFAKYIYARRERKFPARASALDQNPDVDKRSSSKMECGSPSDTPDDTPDGSISC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query793 2.2.26 [Sep-21-2011]
Q8GXJ4959 Glutamate receptor 3.4 OS yes no 0.876 0.724 0.325 1e-114
Q8LGN0952 Glutamate receptor 2.7 OS no no 0.865 0.720 0.341 1e-113
O81078940 Glutamate receptor 2.9 OS no no 0.880 0.742 0.346 1e-108
Q7XJL2921 Glutamate receptor 3.1 OS no no 0.921 0.793 0.307 1e-106
Q93YT1912 Glutamate receptor 3.2 OS no no 0.870 0.756 0.317 1e-105
Q9SW97953 Glutamate receptor 3.5 OS no no 0.866 0.720 0.327 1e-104
O81776896 Glutamate receptor 2.4 OS no no 0.814 0.720 0.346 1e-104
Q9LFN5918 Glutamate receptor 2.5 OS no no 0.880 0.760 0.318 1e-103
Q9SHV1920 Glutamate receptor 2.2 OS no no 0.813 0.701 0.332 1e-102
O04660901 Glutamate receptor 2.1 OS no no 0.894 0.786 0.311 1e-102
>sp|Q8GXJ4|GLR34_ARATH Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2 Back     alignment and function desciption
 Score =  412 bits (1059), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 257/789 (32%), Positives = 410/789 (51%), Gaps = 94/789 (11%)

Query: 2   IKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSA 61
           + E +V   +G ++ G A M++ + +   VP+LSF   A  P L+S ++P+ +R   +  
Sbjct: 121 LMENKVVAAIGPQSSGIAHMISYVANELHVPLLSFG--ATDPTLSSLQFPYFLRTTQNDY 178

Query: 62  EQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYL 121
            Q+   A  +    WR+VI I+ DD    +   +++L + L    S I Y+  + P +  
Sbjct: 179 FQMHAIADFLSYSGWRQVIAIFVDDECGRN--GISVLGDVLAKKRSRISYKAAITPGADS 236

Query: 122 TDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITS 181
           +     +++ L+ +   ESRVF++   +   G+++F  AK +G++    VW IA+D + +
Sbjct: 237 SS----IRDLLVSVNLMESRVFVV-HVNPDSGLNVFSVAKSLGMMASGYVW-IATDWLPT 290

Query: 182 ALGIKTHFSQDS----------SSYKI---FEDQFRSYFRSEYPEDDVSEPGIYALRAYD 228
           A+    H   D+            Y I    + QF + +++  P D  +    YA+ AYD
Sbjct: 291 AMDSMEHVDSDTMDLLQGVVAFRHYTIESSVKRQFMARWKNLRPNDGFNS---YAMYAYD 347

Query: 229 SITVVAKSIDGMTSDNSSSKIS---------------------------LGYILSSNFTG 261
           S+ +VA+++D    +N++   S                           +  IL  N TG
Sbjct: 348 SVWLVARALDVFFRENNNITFSNDPNLHKTNGSTIQLSALSVFNEGEKFMKIILGMNHTG 407

Query: 262 LSGPISFRGGKLLNSPILRIINMVGKKYKEIDFWLPKFGLS----KTLKMEEDKNSSKVG 317
           ++GPI F   +   +P   ++N+ G   + + +W    GLS    +TL       S+   
Sbjct: 408 VTGPIQFDSDRNRVNPAYEVLNLEGTAPRTVGYWSNHSGLSVVHPETLYSRPPNTSTA-- 465

Query: 318 DIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYD 377
              N  +  +I+PG++ + P+G   P + KPL IGVP R ++  +V      NP  +   
Sbjct: 466 ---NQRLKGIIYPGEVTKPPRGWVFPNNGKPLRIGVPNRVSYTDYVS--KDKNPPGV--R 518

Query: 378 GYCIELFYKVLQVLKYDLPYEF---------------------SDYDAAIGDITILVNRT 416
           GYCI++F   +++L Y +P  +                      ++D A+GDITI+ NRT
Sbjct: 519 GYCIDVFEAAIELLPYPVPRTYILYGDGKRNPSYDNLVNEVVADNFDVAVGDITIVTNRT 578

Query: 417 RFVEFSQPYTESGLSMVVPAK-AEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRW 475
           R+V+F+QP+ ESGL +V P K A+ SPW F+KPFT  MW VTG   ++  ++VW LEHR+
Sbjct: 579 RYVDFTQPFIESGLVVVAPVKEAKSSPWSFLKPFTIEMWAVTGGFFLFVGAMVWILEHRF 638

Query: 476 NPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSNLTRLVVVVWLFVVLILNSSYTASLSS 535
           N EF GP   Q+ T  WF+FS++FF+HRE   S+L R V+++WLFVVLI+NSSYTASL+S
Sbjct: 639 NQEFRGPPRRQLITIFWFSFSTMFFSHRENTVSSLGRFVLIIWLFVVLIINSSYTASLTS 698

Query: 536 MLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRNYLENVLGFKPENILKVDHEYKYITDF 595
           +LT+++L   +  I  L  SN  +G    +F RNYL N L   P  I+ +  E +Y++  
Sbjct: 699 ILTIRQLTSRIEGIDSLVTSNEPIGVQDGTFARNYLINELNILPSRIVPLKDEEQYLSAL 758

Query: 596 E----SNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVFQKGSPLAADFSEAI 651
           +    +  +AA   EL Y    L+    ++      +   G+ F FQ+ SPLA D S AI
Sbjct: 759 QRGPNAGGVAAIVDELPYIEVLLTNSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDMSTAI 818

Query: 652 LKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVF 711
           L+LSE GEL  +  KW     EC  S +++N++   LSL+ FWGLFLI G T  +   VF
Sbjct: 819 LQLSEEGELEKIHRKWLNYKHEC--SMQISNSEDSQLSLKSFWGLFLICGITCFMALTVF 876

Query: 712 LVRNYTSRQ 720
             R +   Q
Sbjct: 877 FWRVFWQYQ 885
Glutamate-gated receptor that probably acts as non-selective cation channel, at least in hypocotyls. Can be triggered by Ala, Asn, Gly, Ser and, to a lower extent, Cys and Glu. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells. Play an important role in the calcium-based fast transmission of environmental stress.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8LGN0|GLR27_ARATH Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3 Back     alignment and function description
>sp|O81078|GLR29_ARATH Glutamate receptor 2.9 OS=Arabidopsis thaliana GN=GLR2.9 PE=2 SV=1 Back     alignment and function description
>sp|Q7XJL2|GLR31_ARATH Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2 Back     alignment and function description
>sp|Q93YT1|GLR32_ARATH Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2 Back     alignment and function description
>sp|Q9SW97|GLR35_ARATH Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=GLR3.5 PE=2 SV=2 Back     alignment and function description
>sp|O81776|GLR24_ARATH Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFN5|GLR25_ARATH Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=1 SV=2 Back     alignment and function description
>sp|Q9SHV1|GLR22_ARATH Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1 Back     alignment and function description
>sp|O04660|GLR21_ARATH Glutamate receptor 2.1 OS=Arabidopsis thaliana GN=GLR2.1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
224077014 931 glutamate-gated kainate-type ion channel 0.959 0.817 0.555 0.0
255563044843 glutamate receptor 2 plant, putative [Ri 0.887 0.835 0.605 0.0
224077016784 glutamate-gated kainate-type ion channel 0.912 0.923 0.570 0.0
224114736836 glutamate-gated kainate-type ion channel 0.977 0.927 0.546 0.0
224077012 942 glutamate-gated kainate-type ion channel 0.986 0.830 0.543 0.0
224114740867 glutamate-gated kainate-type ion channel 0.970 0.888 0.531 0.0
225443524 916 PREDICTED: glutamate receptor 2.7-like [ 0.960 0.831 0.524 0.0
147838919 916 hypothetical protein VITISV_034689 [Viti 0.960 0.831 0.524 0.0
356519637 1033 PREDICTED: glutamate receptor 2.7-like [ 0.931 0.715 0.515 0.0
297740467 924 unnamed protein product [Vitis vinifera] 0.960 0.824 0.516 0.0
>gi|224077014|ref|XP_002305093.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222848057|gb|EEE85604.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/821 (55%), Positives = 594/821 (72%), Gaps = 60/821 (7%)

Query: 1   MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSS 60
           +I+E EV+VI+GME W  A +VADIGS+ +VPV+SF+ PAI PPL S+RWPFL+RMA+  
Sbjct: 109 LIEENEVEVIIGMERWEEAALVADIGSQFKVPVISFSAPAITPPLASSRWPFLIRMAHGD 168

Query: 61  AEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISY 120
           + QI C AA++ SYNWR+V+ +YED A                    EIEY LVLPP S+
Sbjct: 169 SNQIRCIAAVIQSYNWRRVVTVYEDYAY------------------GEIEYNLVLPPFSF 210

Query: 121 LTDPKQFLQEKLLKLL--RTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDT 178
           ++DPK  ++E+L KLL  + +SRVFI+LQSSL M IHLFREAK+MGLVG D VW++ +DT
Sbjct: 211 VSDPKDVVREELTKLLSEKIQSRVFIVLQSSLPMMIHLFREAKKMGLVGNDMVWIL-TDT 269

Query: 179 ITS---------------ALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYA 223
           +T+               ALGIK ++  ++SS++ F  QFR  F SEYPE+   EPG YA
Sbjct: 270 VTNFLDIVNTSVIHSMEGALGIKNYYFDNTSSFQTFLTQFRQKFISEYPEECCYEPGFYA 329

Query: 224 LRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIIN 283
           LRA+DSI+++ +++D ++S+  S K  L    +++F GLSG I+ + G+LL+SP+LRI+N
Sbjct: 330 LRAHDSISIITQAMDRLSSNTRSPKSFLDNTFTTSFVGLSGEINVKAGELLHSPMLRIVN 389

Query: 284 MVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMP 343
           +VG++YKE+DFW+P+FG S    + +D   ++   IR  L G VIWPGDL+R+PKG  MP
Sbjct: 390 VVGRRYKELDFWIPEFGFSNQPVVAKDGAENRTEAIR--LKGPVIWPGDLQRNPKGWLMP 447

Query: 344 TDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVLKYDLPYEF---- 399
            D K +IIGVP RT+F+KFVK +S++   K  YDG+CIELFYKVL VL YDLPY+F    
Sbjct: 448 NDTKRMIIGVPGRTSFEKFVK-VSTNAAGKKEYDGFCIELFYKVLGVLAYDLPYQFIPYN 506

Query: 400 ------------SDYDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSPWIFIK 447
                         YDA +GD+TIL +R   VEF+QPY ESGLSM+VPAK ++S W+F+K
Sbjct: 507 GTYDDLVDHVYNKTYDAIVGDVTILASRAEKVEFTQPYAESGLSMIVPAKYKESAWMFMK 566

Query: 448 PFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIY 507
           PFT  MW+VTGA+LIYTM +VWFLEH  NPEFNGPW  QIGTALWFTFSSL+FAHRE+IY
Sbjct: 567 PFTKEMWLVTGAVLIYTMFIVWFLEHHTNPEFNGPWKNQIGTALWFTFSSLYFAHREKIY 626

Query: 508 SNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFV 567
           SNLTR+V+VVWLFVVLILNSSYTASL+SMLTV+RL+PNVTDI WLK ++L VG DGDSFV
Sbjct: 627 SNLTRVVLVVWLFVVLILNSSYTASLASMLTVRRLQPNVTDIEWLKRNSLKVGCDGDSFV 686

Query: 568 RNYLENVLGFKPENILKVDHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPT 627
           RNYL+NVLGFK ENI  V  EY Y  +FES  I+AAFLEL YE+ F+  +CK Y+AT PT
Sbjct: 687 RNYLQNVLGFKQENIKNVSSEYSYEGEFESATISAAFLELPYEKVFIGHYCKRYSATTPT 746

Query: 628 YRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTEC 687
           YRFGG  FVFQKGSP+AAD S+AIL LSE+GEL++LEEKWFA S +C  +A  +N+KTE 
Sbjct: 747 YRFGGLGFVFQKGSPIAADVSKAILNLSEDGELKNLEEKWFAQSRQCFSNA-TDNDKTES 805

Query: 688 LSLQDFWGLFLISGTTSTIC---ALVFLVRNYTSRQDASEGNITSSGRSIWSKMIGFAKY 744
           LSLQ FWG+++I+G TSTIC    L  L++NY  ++    GN T S +S+W K +  A+Y
Sbjct: 806 LSLQSFWGIYIITGATSTICFLLFLFHLLKNYHKQEVEDRGNATPSDKSVWEKTVTLARY 865

Query: 745 IYARRERKFPARASALDQNPDVDKRSSSKMECGSPSDTPDD 785
           IY   E   P  +   + +PD+ + +SS +E  +P DT ++
Sbjct: 866 IY-HGETVTPGESPIPNPSPDIHEWNSSNLELSNPEDTQEN 905

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563044|ref|XP_002522526.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223538217|gb|EEF39826.1| glutamate receptor 2 plant, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224077016|ref|XP_002305094.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222848058|gb|EEE85605.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114736|ref|XP_002316842.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222859907|gb|EEE97454.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224077012|ref|XP_002305092.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222848056|gb|EEE85603.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114740|ref|XP_002316843.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222859908|gb|EEE97455.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443524|ref|XP_002272216.1| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147838919|emb|CAN63664.1| hypothetical protein VITISV_034689 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519637|ref|XP_003528477.1| PREDICTED: glutamate receptor 2.7-like [Glycine max] Back     alignment and taxonomy information
>gi|297740467|emb|CBI30649.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
TAIR|locus:2066148940 GLR2.9 "glutamate receptor 2.9 0.423 0.357 0.394 4e-94
TAIR|locus:2081805903 GLR3.6 "glutamate receptor 3.6 0.641 0.563 0.326 1.1e-91
TAIR|locus:2066107952 GLR2.7 "glutamate receptor 2.7 0.562 0.468 0.342 7e-84
TAIR|locus:2207165959 GLR3.4 "AT1G05200" [Arabidopsi 0.399 0.330 0.423 1e-83
TAIR|locus:2066086947 GLR2.8 "glutamate receptor 2.8 0.585 0.489 0.322 9.2e-81
TAIR|locus:2181196901 GLR2.1 "glutamate receptor 2.1 0.424 0.374 0.345 2.7e-78
TAIR|locus:2122128912 GLUR2 "glutamate receptor 2" [ 0.508 0.441 0.349 1.2e-77
TAIR|locus:2062586921 GLR5 "glutamate receptor 5" [A 0.418 0.360 0.357 7.7e-76
TAIR|locus:2206095933 GLR3.3 "glutamate receptor 3.3 0.390 0.332 0.385 2.2e-68
TAIR|locus:2047256920 GLR2.2 "glutamate receptor 2.2 0.392 0.338 0.354 7.5e-67
TAIR|locus:2066148 GLR2.9 "glutamate receptor 2.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 630 (226.8 bits), Expect = 4.0e-94, Sum P(2) = 4.0e-94
 Identities = 140/355 (39%), Positives = 205/355 (57%)

Query:   394 DLPYEFSD--YDAAIGDITILVNRTRFVEFSQPYTESGLSMVVPAKAEQSP--WIFIKPF 449
             +L Y+  D  +DA +GDITI  NR+ + +F+ P+TESG+SM+VP +  ++   W+F++P+
Sbjct:   506 NLVYQVYDKTWDAVVGDITITANRSLYADFTLPFTESGVSMMVPVRDNENKDTWVFLEPW 565

Query:   450 TWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPWNIQIGTALWFTFSSLFFAHRERIYSN 509
             +  +W+ TG   ++   VVW  EHR N +F GP   QIGT+LWF+FS++ FAHRE + SN
Sbjct:   566 SLELWVTTGCFFVFIGFVVWLFEHRVNTDFRGPPQYQIGTSLWFSFSTMVFAHRENVVSN 625

Query:   510 XXXXXXXXXXXXXXXXNSSYTASLSSMLTVQRLKPNVTDIGWLKASNLNVGFDGDSFVRN 569
                               SYTASL+S LTVQ L+P VT++  L  +   VG+ G +FV++
Sbjct:   626 LARFVVVVWCFVVLVLTQSYTASLTSFLTVQSLQPTVTNVNDLIKNRDCVGYQGGAFVKD 685

Query:   570 YLENVLGFKPENILKVDHEYKYITDF----ESNRIAAAFLELSYERAFLSQHCKEYTATI 625
              L   LGF  E+ LK     K   D     +S  IAAAF E++Y +A LSQ C +Y    
Sbjct:   686 ILLG-LGFH-EDQLKPFDSAKDADDLLSKGKSKGIAAAFDEVAYLKAILSQSCSKYVMVE 743

Query:   626 PTYRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGS-AEVNNNK 684
             PT++ GGF F F K SPL  +FS AIL L++N   + +E++WF    +C      +++N+
Sbjct:   744 PTFKTGGFGFAFPKNSPLTGEFSRAILNLTQNNVTQQIEDRWFPKKNDCPDPMTALSSNR 803

Query:   685 TECLSLQDFWGLFLISGTTSTICALVFLVRN-YTSRQDASEGNITSSGRSIWSKM 738
                L+L  F GLFLI+GT  +   LVF+    Y  R    +     S  S+W K+
Sbjct:   804 ---LNLSSFLGLFLIAGTAISFSLLVFVALFLYEHRHTLGD----DSEDSLWRKL 851
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=NAS
GO:0009416 "response to light stimulus" evidence=NAS
GO:0005515 "protein binding" evidence=IPI
GO:0030003 "cellular cation homeostasis" evidence=RCA
TAIR|locus:2081805 GLR3.6 "glutamate receptor 3.6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066107 GLR2.7 "glutamate receptor 2.7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207165 GLR3.4 "AT1G05200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181196 GLR2.1 "glutamate receptor 2.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122128 GLUR2 "glutamate receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062586 GLR5 "glutamate receptor 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206095 GLR3.3 "glutamate receptor 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047256 GLR2.2 "glutamate receptor 2.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_IV0443
glutamate-gated kainate-type ion channel receptor subunit GluR5 (931 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 8e-64
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 6e-52
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 3e-27
cd06350348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 3e-25
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 9e-21
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 3e-16
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 6e-16
cd06268298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 1e-13
cd06351328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 8e-13
COG0683366 COG0683, LivK, ABC-type branched-chain amino acid 3e-10
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 4e-10
cd06367362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole 4e-10
cd06368324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 6e-09
cd06382327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 1e-06
cd06379377 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i 6e-06
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 1e-05
cd06352389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 2e-05
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 3e-05
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 3e-05
cd06342334 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic l 5e-05
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-04
pfam13458343 pfam13458, Peripla_BP_6, Periplasmic binding prote 2e-04
cd06333312 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasm 2e-04
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 4e-04
cd06345344 cd06345, PBP1_ABC_ligand_binding_like_10, Type I p 4e-04
cd06347334 cd06347, PBP1_ABC_ligand_binding_like_12, Type I p 0.001
cd06363410 cd06363, PBP1_Taste_receptor, Ligand-binding domai 0.002
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information 
 Score =  217 bits (554), Expect = 8e-64
 Identities = 107/327 (32%), Positives = 163/327 (49%), Gaps = 59/327 (18%)

Query: 1   MIKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPL-TSTRWPFLVRMANS 59
           +++ K V  I+G +    A  VA++ +   VPVLSFA  A +P L +  ++P+  R   S
Sbjct: 61  LLENKPVVAIIGPQCSSVAEFVAEVANEWNVPVLSFA--ATSPSLSSRLQYPYFFRTTPS 118

Query: 60  SAEQITCTAALVGSYNWRKVIIIYEDDATNADTGNLAL--LSEALQISNSEIEYRLVLPP 117
            + Q    AAL+  + WR+V  IYEDD    D G+  L  L +ALQ +  EI YR   PP
Sbjct: 119 DSSQNPAIAALLKKFGWRRVATIYEDD----DYGSGGLPDLVDALQEAGIEISYRAAFPP 174

Query: 118 ISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASD 177
            +   D    L+    KL   +SRV + +  S  +   +F EA ++G++G   VW I +D
Sbjct: 175 SANDDDITDALK----KLKEKDSRVIV-VHFSPDLARRVFCEAYKLGMMGKGYVW-ILTD 228

Query: 178 TITSA-------------------LGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSE 218
            ++S                    +G++++    S + + F  ++R  F +E PE  ++E
Sbjct: 229 WLSSNWWSSSDCTDEEMLEAMQGVIGVRSYVPNSSMTLQEFTSRWRKRFGNENPE--LTE 286

Query: 219 PGIYALRAYDSITVVAKSIDGMTSDNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPI 278
           P IYAL AYD++                         S+NF GLSGP+ F GG+ L SP 
Sbjct: 287 PSIYALYAYDAVWA-----------------------STNFNGLSGPVQFDGGRRLASPA 323

Query: 279 LRIINMVGKKYKEIDFWLPKFGLSKTL 305
             IIN++GK Y++I FW  + GLS  L
Sbjct: 324 FEIINIIGKGYRKIGFWSSESGLSVFL 350

Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>gnl|CDD|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|107337 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|222144 pfam13458, Peripla_BP_6, Periplasmic binding protein Back     alignment and domain information
>gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|107340 cd06345, PBP1_ABC_ligand_binding_like_10, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107342 cd06347, PBP1_ABC_ligand_binding_like_12, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 793
KOG1054897 consensus Glutamate-gated AMPA-type ion channel re 100.0
KOG4440993 consensus NMDA selective glutamate-gated ion chann 100.0
KOG1053 1258 consensus Glutamate-gated NMDA-type ion channel re 100.0
KOG1052656 consensus Glutamate-gated kainate-type ion channel 100.0
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 100.0
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 100.0
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 100.0
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 100.0
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 100.0
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 100.0
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 100.0
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 100.0
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 100.0
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 100.0
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 100.0
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 100.0
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 100.0
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 100.0
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 100.0
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 100.0
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 100.0
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 100.0
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 100.0
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 100.0
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 100.0
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 100.0
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 100.0
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 100.0
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 100.0
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 100.0
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 100.0
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 100.0
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 99.98
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 99.98
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 99.98
PF01094348 ANF_receptor: Receptor family ligand binding regio 99.97
KOG1056878 consensus Glutamate-gated metabotropic ion channel 99.97
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 99.97
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 99.96
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 99.96
cd06338345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 99.95
PRK15404369 leucine ABC transporter subunit substrate-binding 99.95
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 99.95
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 99.95
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 99.94
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 99.94
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 99.94
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 99.94
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 99.94
cd06344332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 99.93
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 99.93
COG0683366 LivK ABC-type branched-chain amino acid transport 99.93
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 99.93
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 99.93
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 99.92
cd06359333 PBP1_Nba_like Type I periplasmic binding component 99.92
cd06349340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 99.92
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 99.92
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 99.92
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 99.92
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 99.92
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 99.92
cd06328333 PBP1_SBP_like_2 Periplasmic solute-binding domain 99.91
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 99.91
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 99.91
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 99.91
cd06357360 PBP1_AmiC Periplasmic binding domain of amidase (A 99.9
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 99.9
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 99.9
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 99.9
cd06358333 PBP1_NHase Type I periplasmic-binding protein of t 99.89
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 99.89
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.88
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 99.87
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.87
TIGR03863347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.87
KOG1055865 consensus GABA-B ion channel receptor subunit GABA 99.84
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 99.83
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.83
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.83
PRK11260266 cystine transporter subunit; Provisional 99.8
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.8
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 99.79
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.79
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.78
PRK15007243 putative ABC transporter arginine-biding protein; 99.78
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.78
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 99.77
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.75
PRK15437259 histidine ABC transporter substrate-binding protei 99.74
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.74
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.73
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.72
PF13433363 Peripla_BP_5: Periplasmic binding protein domain; 99.72
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.69
PRK10859482 membrane-bound lytic transglycosylase F; Provision 99.67
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.65
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.63
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.59
TIGR02285268 conserved hypothetical protein. Members of this fa 99.59
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.56
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.53
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.51
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.51
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.41
COG4623 473 Predicted soluble lytic transglycosylase fused to 99.09
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 99.0
PF04348536 LppC: LppC putative lipoprotein; InterPro: IPR0074 98.58
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.53
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 98.39
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 97.99
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 97.79
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 97.64
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 97.55
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 97.42
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.41
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 97.19
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 97.14
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 97.0
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 96.79
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 96.71
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 96.65
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 96.56
COG3107604 LppC Putative lipoprotein [General function predic 96.55
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 96.54
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 96.34
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 96.3
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 96.26
PRK10653295 D-ribose transporter subunit RbsB; Provisional 96.09
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 96.04
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 95.94
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 95.94
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 95.81
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 95.8
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 95.75
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 95.63
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 95.54
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 95.47
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 95.47
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 95.44
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 95.39
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 95.38
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 95.35
PRK11553314 alkanesulfonate transporter substrate-binding subu 95.34
cd06295275 PBP1_CelR Ligand binding domain of a transcription 95.31
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 95.28
COG1609333 PurR Transcriptional regulators [Transcription] 95.25
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 95.14
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 95.09
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 95.09
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 95.02
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 95.01
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 94.94
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 94.85
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 94.84
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 94.84
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 94.81
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 94.7
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 94.7
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 94.69
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 94.64
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 94.37
cd06324305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 94.29
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 94.15
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 94.1
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 94.04
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot 94.0
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 93.91
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 93.81
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 93.7
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharac 93.69
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 93.66
PRK09526342 lacI lac repressor; Reviewed 93.58
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 93.56
cd01544270 PBP1_GalR Ligand-binding domain of DNA transcripti 93.54
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 93.53
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 93.4
PRK10423327 transcriptional repressor RbsR; Provisional 93.25
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 93.19
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 93.15
cd01540289 PBP1_arabinose_binding Periplasmic L-arabinose-bin 93.14
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 93.1
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 93.03
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 92.93
cd06307275 PBP1_uncharacterized_sugar_binding Periplasmic sug 92.8
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 92.79
PRK09701311 D-allose transporter subunit; Provisional 92.78
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 92.5
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 92.25
PRK10936343 TMAO reductase system periplasmic protein TorT; Pr 92.23
COG1879322 RbsB ABC-type sugar transport system, periplasmic 92.16
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 91.96
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 91.87
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 91.82
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 91.81
PRK14987331 gluconate operon transcriptional regulator; Provis 91.67
cd06354265 PBP1_BmpA_PnrA_like Periplasmic binding domain of 91.53
COG2984322 ABC-type uncharacterized transport system, peripla 91.42
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 91.32
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 91.04
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 90.69
PRK09492315 treR trehalose repressor; Provisional 90.5
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 89.97
PRK10339327 DNA-binding transcriptional repressor EbgR; Provis 89.42
TIGR02955295 TMAO_TorT TMAO reductase system periplasmic protei 89.2
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 89.02
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 88.85
PF13377160 Peripla_BP_3: Periplasmic binding protein-like dom 88.21
PRK15395330 methyl-galactoside ABC transporter galactose-bindi 88.12
cd06304260 PBP1_BmpA_like Periplasmic binding component of a 86.97
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 86.52
COG1454377 EutG Alcohol dehydrogenase, class IV [Energy produ 85.88
TIGR02634302 xylF D-xylose ABC transporter, substrate-binding p 85.8
KOG1419654 consensus Voltage-gated K+ channel KCNQ [Inorganic 85.6
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 85.37
PRK11041309 DNA-binding transcriptional regulator CytR; Provis 84.54
PRK10355330 xylF D-xylose transporter subunit XylF; Provisiona 84.41
PRK09860383 putative alcohol dehydrogenase; Provisional 83.87
TIGR02637302 RhaS rhamnose ABC transporter, rhamnose-binding pr 83.41
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 81.79
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 81.33
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 80.56
cd08192370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 80.32
>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-89  Score=692.90  Aligned_cols=658  Identities=20%  Similarity=0.327  Sum_probs=549.7

Q ss_pred             ccceEEEEcCCChhhHHHHHHhccCCCccEEeeeCCCCCCCCCCCCCCeEEEecCChHHHHHHHHHHHhhcCceEEEEEE
Q 003821            4 EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIY   83 (793)
Q Consensus         4 ~~~V~aiiGp~~s~~~~~va~i~~~~~iP~Is~~~~~~~~~l~~~~~~~~~r~~p~~~~~~~ai~~ll~~~~w~~vaii~   83 (793)
                      ++||.||+|-+.-.....+-.+|+..++|+|+++..      ++...+|.+++.|+   ...++++++.||+|.+++++|
T Consensus        88 s~Gv~Aifg~yd~ks~~~ltsfc~aLh~~~vtpsfp------~~~~~~Fviq~RP~---l~~al~s~i~hy~W~~fv~ly  158 (897)
T KOG1054|consen   88 SRGVYAIFGFYDKKSVNTLTSFCGALHVSFVTPSFP------TDGDNQFVIQMRPA---LKGALLSLIDHYKWEKFVYLY  158 (897)
T ss_pred             hhhHhhheecccccchhhhhhhccceeeeeecccCC------cCCCceEEEEeCch---HHHHHHHHHHhcccceEEEEE
Confidence            368999999999999999999999999999998764      24556899999998   678999999999999999999


Q ss_pred             EcCCCccccccHHHHHHHHHhcCceeeEEeecCCCCCCCCChHHHHHHHHHhhcCCceEEEEeccChHHHHHHHHHHHHc
Q 003821           84 EDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEM  163 (793)
Q Consensus        84 ~dd~~G~~~~~~~~l~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~vivvl~~~~~~~~~~l~~a~~~  163 (793)
                      +.|. |  ...++.+-+.+.++++.|... .+....    ....+..+++.+...+.+-+++ +|..+....++.|+.+.
T Consensus       159 D~~r-g--~s~Lqai~~~a~~~nw~VtA~-~v~~~~----d~~~yr~~f~~l~~r~e~rv~i-Dce~~~~~~il~q~i~~  229 (897)
T KOG1054|consen  159 DTDR-G--LSILQAIMEAAAQNNWQVTAI-NVGNIN----DVKEYRMLFEMLDRRQENRVLI-DCESERRNRILLQVIEL  229 (897)
T ss_pred             cccc-h--HHHHHHHHHHHHhcCceEEEE-EcCCcc----cHHHHHHHHHHHhccccceEEE-EcccHHHHHHHHHHHHH
Confidence            9887 6  778888888898999988755 343322    2244888888888777777777 99999999999999999


Q ss_pred             CCCCCCeEEEEeCCcccc------------ceeecccccCCchhhhHHHHHHHHhhhhcCCCCCCCCcchhhHhHhHHHH
Q 003821          164 GLVGPDSVWVIASDTITS------------ALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSIT  231 (793)
Q Consensus       164 g~~~~~~~wi~~~~~~~~------------~~g~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~  231 (793)
                      +-..++|||++.+-++.+            +.|+.. .+..+|..++|.++|++.-..++++..+..+.+.++++|||+.
T Consensus       230 ~k~~~~YHYvlaNl~f~d~dl~~f~~g~aNitgFqi-vn~~~~~~~k~~~~~~~l~~~~~~g~~~~~~k~tsAlthDail  308 (897)
T KOG1054|consen  230 GKHVKGYHYVLANLGFTDIDLERFQHGGANITGFQI-VNKNNPMVKKFIQRWKELDEREYPGASNDPIKYTSALTHDAIL  308 (897)
T ss_pred             hhhccceEEEEeeCCCchhhHHHHhcCCcceeEEEE-ecCCChHHHHHHHHHhhhcccccCCCCCCCcchhhhhhhhHHH
Confidence            998899999999544433            444443 3445588899999999887778888777888999999999999


Q ss_pred             HHHHHHhhccC--------------------CCCChhhHHHhhhhcccccceeeEEEeCCCcCCCCcEEEEEeecceeEE
Q 003821          232 VVAKSIDGMTS--------------------DNSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKE  291 (793)
Q Consensus       232 ~la~Al~~~~~--------------------~~~~g~~l~~~l~~~~f~G~tG~i~Fd~~g~~~~~~~~I~~~~~~~~~~  291 (793)
                      ++++|++.+..                    .|..|..+.++++++.++|+||+|+||..|+|.+.+.+|+++..++.++
T Consensus       309 V~~eaf~~~~~q~~~~~rRG~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~~G~R~Nyt~~i~elk~~~~rk  388 (897)
T KOG1054|consen  309 VMAEAFRSLRRQRIDISRRGNAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDKYGRRTNYTIDIVELKSNGSRK  388 (897)
T ss_pred             HHHHHHHHHHHhhhchhccCCCccccCCCCCchhcchhHHHHHHheeecccccceeecccCccccceEEEEEeccCCcce
Confidence            99999987743                    2467889999999999999999999999999999999999999999999


Q ss_pred             EEEecCCCCCccccccccccCCCcccCcccCCcceeecCCCCccCCCccccCCCCCcEEEEecCCCCccceEEeccCCC-
Q 003821          292 IDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDN-  370 (793)
Q Consensus       292 VG~w~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~v~Wp~~~~~~P~~~~~~~~~~~lrv~~~~~~~~~p~~~~~~~~~-  370 (793)
                      +|+|+...|+......... .++     ..                     ..+.++..|.+....   ||++...+.. 
T Consensus       389 ~~~W~e~~~fv~~~t~a~~-~~d-----~~---------------------~~~n~tvvvttiL~s---pyvm~kkn~~~  438 (897)
T KOG1054|consen  389 VGYWNEGEGFVPGSTVAQS-RND-----QA---------------------SKENRTVVVTTILES---PYVMLKKNHEQ  438 (897)
T ss_pred             eeeecccCceeeccccccc-ccc-----cc---------------------ccccceEEEEEecCC---chhHHHhhHHH
Confidence            9999999887643321110 000     00                     012344555555443   4555554433 


Q ss_pred             -CCcceeeeeeHHHHHHHHHHCCCccceeEE---------------------------EEeEEEecEEEecccccceeec
Q 003821          371 -PHKIIYDGYCIELFYKVLQVLKYDLPYEFS---------------------------DYDAAIGDITILVNRTRFVEFS  422 (793)
Q Consensus       371 -~~~~~~~G~~~dll~~ia~~ln~~~~~~~~---------------------------~~Di~~~~~~~t~~R~~~~dfs  422 (793)
                       .|+++|+|||+||+.+||++.+.+  |++.                           ++|+++++++||.+|++++|||
T Consensus       439 ~egn~ryEGyCvdLa~~iAkhi~~~--Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFS  516 (897)
T KOG1054|consen  439 LEGNERYEGYCVDLAAEIAKHIGIK--YKLFIVGDGKYGARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFS  516 (897)
T ss_pred             hcCCcccceeHHHHHHHHHHhcCce--EEEEEecCCcccccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccc
Confidence             456699999999999999999998  7655                           9999999999999999999999


Q ss_pred             ccccccceEEEEecCCC--CCCcEEecCCChhHHHHHHHHHHHHHHHHHhhhcccCCCCC------CCc-------cccc
Q 003821          423 QPYTESGLSMVVPAKAE--QSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFN------GPW-------NIQI  487 (793)
Q Consensus       423 ~p~~~~~~~~~v~~~~~--~~~~~~l~PF~~~vWl~i~~~~i~~~~~~~~~~~~~~~~~~------~~~-------~~~~  487 (793)
                      .|||..|++|++++|++  .+.++|+.|+..++|+|++...+.+++++++..|+++.||+      |+.       ..++
T Consensus       517 KPfMslGISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEwh~Ee~~rg~~t~~~~~NeFgi  596 (897)
T KOG1054|consen  517 KPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFERGRFTPSDPPNEFGI  596 (897)
T ss_pred             cchhhcCeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchheeccccccCCCCCCCCCccchh
Confidence            99999999999988874  34899999999999999999999999999999999987654      222       2358


Q ss_pred             hhHHHHHHHHHhhccccc-cccchhhHHHHHHHHHHHHHHHHHHhhhheeeeeccCCCCCCChHHh-hhCCCcccccCch
Q 003821          488 GTALWFTFSSLFFAHRER-IYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWL-KASNLNVGFDGDS  565 (793)
Q Consensus       488 ~~~~~~~~~~l~~~~~~~-~~s~s~R~l~~~w~~~~lil~~~Yta~L~s~Lt~~~~~~~i~sl~dL-~~~~~~~g~~~~~  565 (793)
                      .|++||++++++|||++. ||+.|+|++.++||||+|||+++|||||+||||++++.+||.|.||| +|+.+.+|+.++.
T Consensus       597 fNsLWFsLgAFMQQG~DI~PRslSGRIvggvWWFFTlIIiSSYTANLAAFLTvErMvsPIESaEDLAkQteIaYGt~~~G  676 (897)
T KOG1054|consen  597 FNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSG  676 (897)
T ss_pred             hHHHHHHHHHHHhcCCCCCccccccceeccchhhhhhhhhhhhhhHHHHHHhHHhhcCcchhHHHHhhcceeeeeecCCC
Confidence            899999999999999875 79999999999999999999999999999999999999999999999 5899999997776


Q ss_pred             HHHHHHHhhcCCCCccccccC----------------CHHHHHHHhh-cCceEEEEechhhHHHHHhc-cCCceEEeCcc
Q 003821          566 FVRNYLENVLGFKPENILKVD----------------HEYKYITDFE-SNRIAAAFLELSYERAFLSQ-HCKEYTATIPT  627 (793)
Q Consensus       566 ~~~~~l~~~~~~~~~~~~~~~----------------~~~~~~~~l~-~g~~~a~~~~~~~~~~~~~~-~c~~~~~~~~~  627 (793)
                      ...+++++.      ++..|+                +..|++.+++ +++-+|+++|.+..+|.-++ .|+ .+.++..
T Consensus       677 STkeFFr~S------kiavy~kMW~yM~SaepsVFv~t~aeGv~rVRksKGkyAfLLEsTmNey~eqRkPCD-TMKVGgN  749 (897)
T KOG1054|consen  677 STKEFFRRS------KIAVYEKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAFLLESTMNEYIEQRKPCD-TMKVGGN  749 (897)
T ss_pred             chHHHHhhh------hHHHHHHHHHHHhcCCcceeeehhhhHHHHHHhcCCceEeehHhhhhhhhhccCCcc-ceecccc
Confidence            677776653      333333                4455556665 33458999999999987655 788 5667888


Q ss_pred             ccccceEEEecCCCcChHHHHHHHHhhhccCchHHHHHHHcCCCCCCCCCcccCCCccccccccchhHHHHHHHHHHHHH
Q 003821          628 YRFGGFAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTIC  707 (793)
Q Consensus       628 ~~~~~~~~~~~k~spl~~~in~~i~~l~e~G~~~~~~~~w~~~~~~c~~~~~~~~~~~~~L~l~~l~g~f~il~~g~~ls  707 (793)
                      +.+.+||+|.||||.|+..+|.++++|.|.|+++++++|||.++++|.....+..+..++|++.++.|+||||..|++||
T Consensus       750 Lds~GYGiATp~Gsslr~~vNLAvLkL~E~G~LdKLkNKWWYDkGeC~sg~~ds~~ktsaLsLSnVAGvFYIL~gGl~la  829 (897)
T KOG1054|consen  750 LDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLA  829 (897)
T ss_pred             cCCcceeecCCCCcccccchhhhhhhhcccchHHHhhhhhcccccccCCCCCCCCcchhhcchhhccceeeeehhhHHHH
Confidence            99999999999999999999999999999999999999999999999988655666778999999999999999999999


Q ss_pred             HHHHHHH-Hhhhc
Q 003821          708 ALVFLVR-NYTSR  719 (793)
Q Consensus       708 ~lvf~~E-~~~~~  719 (793)
                      .++.++| .|+.+
T Consensus       830 MlvALiEF~yksr  842 (897)
T KOG1054|consen  830 MLVALIEFCYKSR  842 (897)
T ss_pred             HHHHHHHHHHHhh
Confidence            9999999 45544

>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>KOG1056 consensus Glutamate-gated metabotropic ion channel receptor subunit GRM2 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>KOG1055 consensus GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PF13377 Peripla_BP_3: Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A Back     alignment and domain information
>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional Back     alignment and domain information
>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
3kg2_A823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 9e-13
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 97/411 (23%), Positives = 158/411 (38%), Gaps = 73/411 (17%)
Query: 376 YDGYCIELFYKVLQV--LKYDL-----------------------PYEFSDYDAAIGDIT 410
           Y+GYC++L  ++ +    KY L                          +   D AI  +T
Sbjct: 412 YEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLT 471
Query: 411 ILVNRTRFVEFSQPYTESGLSMVV--PAKAEQSPWIFIKPFTWGMWIVTGAILIYT-MSV 467
           I + R   ++FS+P+   G+S+++  P K++   + F+ P  + +W+    +  Y  +SV
Sbjct: 472 ITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCI--VFAYIGVSV 529
Query: 468 VWFLEHRWNP------EFNGPWNIQ---------IGTALWFTFSSLFFAHRERIYSNXXX 512
           V FL  R++P      EF      Q         I  +LWF+  + F      I      
Sbjct: 530 VLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGA-FMQQGADISPRSLS 588
Query: 513 XXXXXXX--XXXXXXNSSYTASLSSMLTVQRLKPNVTDIGWL-KASNLNVGFDGDSFVRN 569
                           SSYTA+L++ LTV+R+   +     L K + +  G       + 
Sbjct: 589 GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKE 648
Query: 570 YLENVLGFKPENILKVDHEYKYITDFESN-----------RIAAAFLELSYERAFLSQHC 618
           +      F+   I   D  + Y+   E +           R+  +  + +Y         
Sbjct: 649 F------FRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEY 702
Query: 619 KEYTATIPTYRFGG------FAFVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSP 672
            E      T + GG      +     KGS L    + A+LKLSE G L  L+ KW+    
Sbjct: 703 IEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKG 762
Query: 673 ECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVR-NYTSRQDA 722
           EC      +  KT  LSL +  G+F I      +  LV L+   Y SR +A
Sbjct: 763 ECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEA 813

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 1e-136
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 7e-45
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 3e-43
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 8e-43
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 2e-40
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 2e-39
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 2e-33
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 3e-32
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 9e-30
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 1e-29
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 1e-23
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
4evq_A375 Putative ABC transporter subunit, substrate-bindi 4e-12
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 2e-11
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 8e-11
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 4e-10
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 5e-10
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 9e-07
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 7e-10
3ipc_A356 ABC transporter, substrate binding protein (amino; 7e-10
3hut_A358 Putative branched-chain amino acid ABC transporter 2e-09
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 5e-09
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 5e-05
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 5e-09
1usg_A346 Leucine-specific binding protein; leucine-binding 1e-08
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 3e-08
3lop_A364 Substrate binding periplasmic protein; protein str 4e-08
3snr_A362 Extracellular ligand-binding receptor; structural 5e-08
3sg0_A386 Extracellular ligand-binding receptor; structural 6e-08
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 6e-07
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 6e-07
3td9_A366 Branched chain amino acid ABC transporter, peripl 7e-07
3h5l_A419 Putative branched-chain amino acid ABC transporter 7e-07
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 8e-07
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 1e-06
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-06
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-04
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-06
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 4e-05
3k4u_A245 Binding component of ABC transporter; structural g 3e-06
3del_B242 Arginine binding protein; alpha and beta protein ( 3e-06
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 3e-06
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 4e-06
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 4e-06
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 5e-06
3hv1_A268 Polar amino acid ABC uptake transporter substrate 1e-05
2q88_A257 EHUB, putative ABC transporter amino acid-binding 1e-05
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 1e-05
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 2e-05
3lkb_A392 Probable branched-chain amino acid ABC transporter 2e-05
3qax_A268 Probable ABC transporter arginine-binding protein; 2e-05
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 3e-05
2o1m_A258 Probable amino-acid ABC transporter extracellular- 3e-05
2yln_A283 Putative ABC transporter, periplasmic binding Pro 4e-05
4eq9_A246 ABC transporter substrate-binding protein-amino A 9e-05
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 9e-05
3tql_A227 Arginine-binding protein; transport and binding pr 4e-04
3kzg_A237 Arginine 3RD transport system periplasmic binding 8e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  423 bits (1088), Expect = e-136
 Identities = 136/808 (16%), Positives = 252/808 (31%), Gaps = 137/808 (16%)

Query: 4   EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQ 63
            + V  I G     +   +        V  ++ + P      T    PF+++M       
Sbjct: 58  SRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFP------TDGTHPFVIQMRPDLKGA 111

Query: 64  ITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTD 123
           +    +L+  Y W K   +Y+ D        L  + ++      ++    V   I+    
Sbjct: 112 L---LSLIEYYQWDKFAYLYDSDR---GLSTLQAVLDSAAEKKWQVTAINVGN-INNDKK 164

Query: 124 PKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVIASDTITSA- 182
            + +    L + L  +    +IL         +  +   +G       ++IA+   T   
Sbjct: 165 DETYRS--LFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGD 222

Query: 183 -----------LGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSIT 231
                       G +     D S    F +++ +    EYP    +     +   YD++ 
Sbjct: 223 LLKIQFGGAEVSGFQIV-DYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQ 281

Query: 232 VVAKSIDGMTSDNSSSKIS--------------------LGYILSSNFTGLSGPISFRGG 271
           V+ ++   +                                 +      GLSG I F   
Sbjct: 282 VMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQN 341

Query: 272 KLLNSPILRIINMVGKKYKEIDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPG 331
               +  + I+ +     ++I +W     +  T                       +   
Sbjct: 342 GKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDDTSGLE------------QKTVVVT 389

Query: 332 DLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISSDNPHKIIYDGYCIELFYKVLQVL 391
            +   P    M       + G                       Y+GYC++L  ++ +  
Sbjct: 390 TILESP--YVMMKANHAALAG--------------------NERYEGYCVDLAAEIAKHC 427

Query: 392 KYDLPYEFS-------------------------DYDAAIGDITILVNRTRFVEFSQPYT 426
            +                                  D AI  +TI + R   ++FS+P+ 
Sbjct: 428 GFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFM 487

Query: 427 ESGLSMVV--PAKAEQSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEH-----RWNPEF 479
             G+S+++  P K++   + F+ P  + +W+      I    V++ +           EF
Sbjct: 488 SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEF 547

Query: 480 NGPWNIQ---------IGTALWFTFSSLFFAHRERIYSNL-TRLVVVVWLFVVLILNSSY 529
                 Q         I  +LWF+  +      +    +L  R+V  VW F  LI+ SSY
Sbjct: 548 EDGRETQSSESTNEFGIFNSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSY 607

Query: 530 TASLSSMLTVQRLKPNVTDIGWLKASN-LNVGFDGDSFVRNYLENVLGFKPENILKV--- 585
           TA+L++ LTV+R+   +     L     +  G       + +         + +      
Sbjct: 608 TANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRS 667

Query: 586 --------DHEYKYITDFESNRIAAAFLELSYERAFLSQHCKEYTATIPTYRFGGFAFVF 637
                             +S    A  LE +       +   +           G+    
Sbjct: 668 AEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT 727

Query: 638 QKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLF 697
            KGS L    + A+LKLSE G L  L+ KW+    EC      +  KT  LSL +  G+F
Sbjct: 728 PKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVF 787

Query: 698 LISGTTSTICALVFLVRN-YTSRQDASE 724
            I      +  LV L+   Y SR +A  
Sbjct: 788 YILVGGLGLAMLVALIEFCYKSRAEAKR 815
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Length = 375 Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Length = 368 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} PDB: 2e4z_A* Length = 481 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Length = 496 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Length = 364 Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Length = 386 Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Length = 479 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Length = 366 Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Length = 419 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Length = 555 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Length = 392 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 100.0
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 100.0
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 100.0
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 100.0
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 100.0
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 100.0
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 100.0
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 100.0
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 100.0
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 100.0
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 100.0
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 100.0
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 100.0
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 100.0
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 100.0
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 99.98
3td9_A366 Branched chain amino acid ABC transporter, peripl 99.97
3i45_A387 Twin-arginine translocation pathway signal protei; 99.97
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 99.96
3ipc_A356 ABC transporter, substrate binding protein (amino; 99.96
4evq_A375 Putative ABC transporter subunit, substrate-bindi 99.96
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 99.96
3n0w_A379 ABC branched chain amino acid family transporter, 99.96
3hut_A358 Putative branched-chain amino acid ABC transporter 99.96
3h5l_A419 Putative branched-chain amino acid ABC transporter 99.96
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 99.95
1usg_A346 Leucine-specific binding protein; leucine-binding 99.95
3lkb_A392 Probable branched-chain amino acid ABC transporter 99.95
3lop_A364 Substrate binding periplasmic protein; protein str 99.94
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 99.94
3n0x_A374 Possible substrate binding protein of ABC transpo 99.94
4gnr_A353 ABC transporter substrate-binding protein-branche 99.94
3sg0_A386 Extracellular ligand-binding receptor; structural 99.93
3snr_A362 Extracellular ligand-binding receptor; structural 99.93
1pea_A385 Amidase operon; gene regulator, receptor, binding 99.92
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.9
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.89
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.88
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.87
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.87
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.87
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.86
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 99.86
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 99.86
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.85
3k4u_A245 Binding component of ABC transporter; structural g 99.84
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.84
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.84
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.83
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.82
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.82
3del_B242 Arginine binding protein; alpha and beta protein ( 99.82
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.81
3tql_A227 Arginine-binding protein; transport and binding pr 99.81
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.8
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.8
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.8
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.79
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.79
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.79
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.78
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.78
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.76
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.75
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.75
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.74
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.74
3qax_A268 Probable ABC transporter arginine-binding protein; 99.73
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.72
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.72
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.72
2vha_A287 Periplasmic binding transport protein; periplasmic 99.71
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.56
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.21
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.2
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.15
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 97.06
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 96.83
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 96.81
2rjo_A332 Twin-arginine translocation pathway signal protei; 96.81
2f5x_A312 BUGD; periplasmic binding protein, transport prote 96.8
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 96.79
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 96.78
3c3k_A285 Alanine racemase; structural genomics, protein str 96.78
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 96.65
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 96.63
2iks_A293 DNA-binding transcriptional dual regulator; escher 96.58
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 96.57
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 96.56
3brs_A289 Periplasmic binding protein/LACI transcriptional; 96.56
2qu7_A288 Putative transcriptional regulator; structural gen 96.54
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 96.51
3g85_A289 Transcriptional regulator (LACI family); transcrip 96.48
3k4h_A292 Putative transcriptional regulator; structural gen 96.44
2x7x_A325 Sensor protein; transferase, sensor histidine kina 96.43
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 96.43
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 96.42
3o74_A272 Fructose transport system repressor FRUR; dual tra 96.42
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 96.4
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 96.4
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 96.35
3h75_A350 Periplasmic sugar-binding domain protein; protein 96.35
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 96.32
3gv0_A288 Transcriptional regulator, LACI family; transcript 96.31
3bbl_A287 Regulatory protein of LACI family; protein structu 96.29
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 96.26
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 96.22
3k9c_A289 Transcriptional regulator, LACI family protein; PS 96.18
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 96.17
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 96.16
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 96.15
2a9h_A155 Voltage-gated potassium channel; potassium channel 96.14
3qk7_A294 Transcriptional regulators; structural genomics, N 96.09
3gyb_A280 Transcriptional regulators (LACI-family transcript 96.05
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 96.05
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 96.04
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 96.04
3d02_A303 Putative LACI-type transcriptional regulator; peri 96.03
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 96.01
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 96.0
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 96.0
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 95.97
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 95.91
1tjy_A316 Sugar transport protein; protein-ligand complex, s 95.89
3egc_A291 Putative ribose operon repressor; structural genom 95.88
3kke_A303 LACI family transcriptional regulator; structural 95.87
3l6u_A293 ABC-type sugar transport system periplasmic compo; 95.8
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 95.74
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 95.72
3qsl_A346 Putative exported protein; unknown, structural gen 95.64
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 95.58
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 95.55
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 95.36
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 95.25
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 95.22
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 95.15
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 95.1
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 95.09
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 95.07
3e3m_A355 Transcriptional regulator, LACI family; structural 95.03
3e61_A277 Putative transcriptional repressor of ribose OPER; 94.97
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 94.94
2qh8_A302 Uncharacterized protein; conserved domain protein, 94.92
3jvd_A333 Transcriptional regulators; structural genomics, P 94.83
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 94.74
3gbv_A304 Putative LACI-family transcriptional regulator; NY 94.63
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 94.62
3bil_A348 Probable LACI-family transcriptional regulator; st 94.59
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 94.45
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 94.44
3ouf_A97 Potassium channel protein; ION channel, membrane, 94.36
1byk_A255 Protein (trehalose operon repressor); LACI family, 94.36
1jye_A349 Lactose operon repressor; gene regulation, protein 94.27
3h5o_A339 Transcriptional regulator GNTR; transcription regu 94.06
2q67_A114 Potassium channel protein; inverted teepee, helix 94.06
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 93.98
1gud_A288 ALBP, D-allose-binding periplasmic protein; peripl 93.33
8abp_A306 L-arabinose-binding protein; binding proteins; HET 93.24
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 93.23
1p7b_A333 Integral membrane channel and cytosolic domains; t 92.66
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 92.61
1xl4_A301 Inward rectifier potassium channel; integral membr 92.26
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 92.26
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 92.05
3miz_A301 Putative transcriptional regulator protein, LACI f 91.94
3uug_A330 Multiple sugar-binding periplasmic receptor CHVE; 91.81
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 91.69
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 91.53
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 90.86
3qi7_A371 Putative transcriptional regulator; periplasmic bi 90.8
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 89.29
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 89.18
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 88.72
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 88.7
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 88.3
1lnq_A336 MTHK channels, potassium channel related protein; 88.03
3lkv_A302 Uncharacterized conserved domain protein; ATPase b 83.95
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 82.89
3ukm_A280 Potassium channel subfamily K member 1; membrane p 80.88
2g29_A417 Nitrate transport protein NRTA; solute-binding pro 80.44
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=3.4e-87  Score=805.68  Aligned_cols=663  Identities=19%  Similarity=0.280  Sum_probs=545.3

Q ss_pred             ccceEEEEcCCChhhHHHHHHhccCCCccEEeeeCCCCCCCCCCCCCCeEEEecCChHHHHHHHHHHHhhcCceEEEEEE
Q 003821            4 EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSAEQITCTAALVGSYNWRKVIIIY   83 (793)
Q Consensus         4 ~~~V~aiiGp~~s~~~~~va~i~~~~~iP~Is~~~~~~~~~l~~~~~~~~~r~~p~~~~~~~ai~~ll~~~~w~~vaii~   83 (793)
                      +++|.|||||.+|..+.+++++++.++||+|+++.    +.+  ..++|+||+.|+   |+.+++++++++||++|++||
T Consensus        58 ~~~V~aiiG~~~S~~~~a~~~i~~~~~iP~is~~~----~~~--~~~~~~~r~~p~---~~~a~~~l~~~~gw~~v~ii~  128 (823)
T 3kg2_A           58 SRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSF----PTD--GTHPFVIQMRPD---LKGALLSLIEYYQWDKFAYLY  128 (823)
T ss_dssp             HTTCSEEEECCCTTTHHHHHHHHHHTTCEEEECSC----CCS--SCCSSEEECSCC---CHHHHHHHHHHTTCSEEEEEE
T ss_pred             hcCcEEEEcCCChhHHHHHHHHhhcCCCceeeccc----CCC--CCCceEEEeCCC---HHHHHHHHHHHCCCCEEEEEE
Confidence            45899999999999999999999999999999733    333  357899999999   899999999999999999999


Q ss_pred             EcCCCccccccHHHHHHHHHhcCceeeEEeecCCCCCCCCChHHHHHHHHHhhcCCceEEEEeccChHHHHHHHHHHHHc
Q 003821           84 EDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEM  163 (793)
Q Consensus        84 ~dd~~G~~~~~~~~l~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~vivvl~~~~~~~~~~l~~a~~~  163 (793)
                       ||+||  .+.++.+.+++++.|+||+....++...  .....|+..++.+|+++++|+||+ ++..+++..++++|+++
T Consensus       129 -d~~~g--~~~~~~~~~~~~~~g~~v~~~~~~~~~~--~~~~~d~~~~l~~i~~~~~~vii~-~~~~~~~~~~~~~a~~~  202 (823)
T 3kg2_A          129 -DSDRG--LSTLQAVLDSAAEKKWQVTAINVGNINN--DKKDETYRSLFQDLELKKERRVIL-DCERDKVNDIVDQVITI  202 (823)
T ss_dssp             -CGGGC--THHHHHHHHHHHHTTCEEEEEECSSCCS--SSTTTTTTTHHHHTTTTTCCEEEE-ECCHHHHHHHHHHHHHH
T ss_pred             -eCChh--HHHHHHHHHHhhccCCceEEEEeecCCC--CccchhHHHHHHHHHhcCCeEEEE-ECCHHHHHHHHHHHHHc
Confidence             77889  9999999999999999999887776541  011256888999999999999999 99999999999999999


Q ss_pred             CCCCCCeEEEEeCCcccc------------ceeecccccCCchhhhHHHHHHHHhhhhcCCCCCCCCcchhhHhHhHHHH
Q 003821          164 GLVGPDSVWVIASDTITS------------ALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEPGIYALRAYDSIT  231 (793)
Q Consensus       164 g~~~~~~~wi~~~~~~~~------------~~g~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~  231 (793)
                      ||.+++|+||.++.+..+            ++++..+.+. .|.+++|.++|+++++.+++......|+.+++++||||+
T Consensus       203 g~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~  281 (823)
T 3kg2_A          203 GKHVKGYHYIIANLGFTDGDLLKIQFGGAEVSGFQIVDYD-DSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQ  281 (823)
T ss_dssp             TTTBTTCEEEECSSBSSSSCCSSSSSSBCEEEEEESSCTT-SHHHHHHHHHHTTSCTTTSTTCCSSCCCHHHHHHHHHHH
T ss_pred             CcCCCCeEEEEecccccccchHHhhcCCCCceEeeeecCC-chHHHHHHHHHHhhcccccCCCCccccchhhHHHHHHHH
Confidence            999999999999323221            3444444333 488999999999988877766555668889999999999


Q ss_pred             HHHHHHhhccCC--------------------CCChhhHHHhhhhcccccceeeEEEeCCCcCCCCcEEEEEeecceeEE
Q 003821          232 VVAKSIDGMTSD--------------------NSSSKISLGYILSSNFTGLSGPISFRGGKLLNSPILRIINMVGKKYKE  291 (793)
Q Consensus       232 ~la~Al~~~~~~--------------------~~~g~~l~~~l~~~~f~G~tG~i~Fd~~g~~~~~~~~I~~~~~~~~~~  291 (793)
                      ++|+|+++++.+                    +.+|.+|.++|++++|+|++|+++||++|++.++.++|+++.++++++
T Consensus       282 ~la~Al~~~~~~~~~~~~~~~~~~c~~~~~~~~~~g~~l~~~l~~~~f~G~tG~i~fd~~G~~~~~~~~I~~~~~~g~~~  361 (823)
T 3kg2_A          282 VMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRK  361 (823)
T ss_dssp             HHHHHHHHHHTTTCCCCCSSCCCCTTCSSCCCCTHHHHHHHHHTTCCCEETTEECCBCSSSCBCSCEEEEEEECSSCEEE
T ss_pred             HHHHHHHHHHhhccccccCCCCCCccCCCCCcccchHHHHHHHHhcccCCcccCeEECCCCcccccEEEEEEEcCCCCee
Confidence            999999997641                    356889999999999999999999999999988999999999999999


Q ss_pred             EEEecCCCCCccccccccccCCCcccCcccCCcceeecCCCCccCCCccccCCCCCcEEEEecCCCCccceEEeccC--C
Q 003821          292 IDFWLPKFGLSKTLKMEEDKNSSKVGDIRNGLIGAVIWPGDLKRDPKGRAMPTDAKPLIIGVPARTTFDKFVKLISS--D  369 (793)
Q Consensus       292 VG~w~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~v~Wp~~~~~~P~~~~~~~~~~~lrv~~~~~~~~~p~~~~~~~--~  369 (793)
                      ||.|++..|+.....                               +.  ...++++|+|++...+||   ++.+++  +
T Consensus       362 vg~w~~~~g~~~~~~-------------------------------~~--~~~~~~~l~v~~~~~~P~---~~~~~~~~~  405 (823)
T 3kg2_A          362 IGYWSEVDKMVLTED-------------------------------DT--SGLEQKTVVVTTILESPY---VMMKANHAA  405 (823)
T ss_dssp             EEEEETTTEEEECCC-------------------------------CC--SSCCCCCEEEEECCCTTT---SEECTTGGG
T ss_pred             EEEEcCCCCceeccC-------------------------------cc--cccCCCEEEEEEecCCCc---EEEecCccc
Confidence            999999887653220                               00  012468899999766544   554321  1


Q ss_pred             CCCcceeeeeeHHHHHHHHHHCCCccceeEE-------------------------EEeEEEecEEEecccccceeeccc
Q 003821          370 NPHKIIYDGYCIELFYKVLQVLKYDLPYEFS-------------------------DYDAAIGDITILVNRTRFVEFSQP  424 (793)
Q Consensus       370 ~~~~~~~~G~~~dll~~ia~~ln~~~~~~~~-------------------------~~Di~~~~~~~t~~R~~~~dfs~p  424 (793)
                      .+++.++.|||+||++++++++||++++...                         ++|++++++++|++|.+.+|||.|
T Consensus       406 ~~~~~~~~G~~~dl~~~~a~~l~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~~D~~~~~~~~t~~R~~~~dfs~p  485 (823)
T 3kg2_A          406 LAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKP  485 (823)
T ss_dssp             CCGGGGEESHHHHHHHHHHHHHTCCEEEEECSSCCCCCBCTTTCCBCHHHHHHHTTSCSEECSCCBCCHHHHTTEEECSC
T ss_pred             cCCCCceEEEHHHHHHHHHHHcCCcEEEEEccCCcccccCCCCCchhhHHHhhccccCcEEecceecchhheeeEEeccc
Confidence            1234489999999999999999999555441                         899999999999999999999999


Q ss_pred             ccccceEEEEecCCC--CCCcEEecCCChhHHHHHHHHHHHHHHHHHhhhcccCCCCCCCc--------------cccch
Q 003821          425 YTESGLSMVVPAKAE--QSPWIFIKPFTWGMWIVTGAILIYTMSVVWFLEHRWNPEFNGPW--------------NIQIG  488 (793)
Q Consensus       425 ~~~~~~~~~v~~~~~--~~~~~~l~PF~~~vWl~i~~~~i~~~~~~~~~~~~~~~~~~~~~--------------~~~~~  488 (793)
                      |+.+++++++|++.+  .+++.|++||++.+|++++++++++++++|+++|..+.+++.+.              ..++.
T Consensus       486 y~~~~~~~~v~~~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~w~~~~~~~~~~~~~~~~~~~~~~~  565 (823)
T 3kg2_A          486 FMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIF  565 (823)
T ss_dssp             SEEECEEEEEECCCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC-----------------------CHHHHHH
T ss_pred             hhhCCEEEEEECCCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhhccCcccccccccccccccccccHH
Confidence            999999999998864  34889999999999999999999999999999998654433211              22477


Q ss_pred             hHHHHHHHHHhhccc-cccccchhhHHHHHHHHHHHHHHHHHHhhhheeeeeccCCCCCCChHHhhh-CCCcccccCchH
Q 003821          489 TALWFTFSSLFFAHR-ERIYSNLTRLVVVVWLFVVLILNSSYTASLSSMLTVQRLKPNVTDIGWLKA-SNLNVGFDGDSF  566 (793)
Q Consensus       489 ~~~~~~~~~l~~~~~-~~~~s~s~R~l~~~w~~~~lil~~~Yta~L~s~Lt~~~~~~~i~sl~dL~~-~~~~~g~~~~~~  566 (793)
                      +++|++++++++||. ..|++.++|+++++||+++||++++|||+|+|+||.+++.++|+|++||.+ +++++|+..++.
T Consensus       566 ~~~~~~~~~l~~~g~~~~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s~Lt~~~~~~~I~s~~dL~~~~~i~~~~~~~~~  645 (823)
T 3kg2_A          566 NSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGS  645 (823)
T ss_dssp             HHHHHTTTTSCC------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCSSHHHHHCCSSEEECBSSSH
T ss_pred             HHHHHHHHHHHhcCCCcCCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCHHHHhhCCCeeEEEEeCCc
Confidence            999999999999994 467999999999999999999999999999999999999999999999975 467888876666


Q ss_pred             HHHHHHhhcCCC----------CccccccCCHHHHHHHhh-cCceEEEEechhhHHHHHhcc-CCceEEeCccccccceE
Q 003821          567 VRNYLENVLGFK----------PENILKVDHEYKYITDFE-SNRIAAAFLELSYERAFLSQH-CKEYTATIPTYRFGGFA  634 (793)
Q Consensus       567 ~~~~l~~~~~~~----------~~~~~~~~~~~~~~~~l~-~g~~~a~~~~~~~~~~~~~~~-c~~~~~~~~~~~~~~~~  634 (793)
                      ...++.+.....          ......+.+.++++++++ +++.+|++.+.+.++|+.+++ |+ ++.+++.+...+|+
T Consensus       646 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~y~~~~~~c~-l~~v~~~~~~~~~~  724 (823)
T 3kg2_A          646 TKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD-TMKVGGNLDSKGYG  724 (823)
T ss_dssp             HHHHHHHCCCHHHHHHHHHHHHCSSCCCBSSHHHHHHHHHTTTTSEEEEEEHHHHHHHHTSTTCC-EEEESCCSSCEEEC
T ss_pred             HHHHHHhccchHHHHHHHHHHhcCCccccCCHHHHHHHHhccCCceEEEechHHHHHHHhcCCCc-eEEcccccccccee
Confidence            777776531100          001123468899999997 566689999999999888776 88 88889999999999


Q ss_pred             EEecCCCcChHHHHHHHHhhhccCchHHHHHHHcCCCCCCCCCcccCCCccccccccchhHHHHHHHHHHHHHHHHHHHH
Q 003821          635 FVFQKGSPLAADFSEAILKLSENGELRSLEEKWFAPSPECSGSAEVNNNKTECLSLQDFWGLFLISGTTSTICALVFLVR  714 (793)
Q Consensus       635 ~~~~k~spl~~~in~~i~~l~e~G~~~~~~~~w~~~~~~c~~~~~~~~~~~~~L~l~~l~g~f~il~~g~~ls~lvf~~E  714 (793)
                      +++||||||++.||++|++|+|+|++++|.++|+...+.|............+|+++++.|+|+++++|+++|+++|++|
T Consensus       725 ~~~~k~spl~~~~~~~il~l~e~G~~~~~~~~w~~~~~~c~~~~~~~~~~~~~L~l~~l~g~f~il~~g~~la~~vf~~E  804 (823)
T 3kg2_A          725 IATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIE  804 (823)
T ss_dssp             CEEETTCSSHHHHHHHHHHHHHTTHHHHHHHHHHTTSCSCSSTTTSTTTCCCSCCSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EeecCCChHHHHHHHHHHHHHhCCcHHHHHHhhCcCCCCCCCCCccccccCCccchhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998888998763233356679999999999999999999999999999


Q ss_pred             Hhhhc
Q 003821          715 NYTSR  719 (793)
Q Consensus       715 ~~~~~  719 (793)
                      +..++
T Consensus       805 ~~~~~  809 (823)
T 3kg2_A          805 FCYKS  809 (823)
T ss_dssp             HHHC-
T ss_pred             HHHHc
Confidence            54443
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3qi7_A Putative transcriptional regulator; periplasmic binding protein-like, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.86A {Clostridium difficile} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 793
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 1e-19
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 1e-12
d1ewka_477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 3e-12
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 1e-11
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-11
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 2e-08
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 3e-08
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 0.001
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 1e-07
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 2e-05
d1lsta_238 c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding 5e-05
d1usga_346 c.93.1.1 (A:) Leucine-binding protein {Escherichia 2e-04
d1xt8a1248 c.94.1.1 (A:10-257) Putative amino-acid transporte 0.001
d3ckma1317 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemo 0.004
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.2 bits (222), Expect = 1e-19
 Identities = 47/333 (14%), Positives = 108/333 (32%), Gaps = 38/333 (11%)

Query: 2   IKEKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTSTRWPFLVRMANSSA 61
            +  +  +I+G     AA  VA + S   +P+LS    A       + +  L R+A + A
Sbjct: 78  ARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYA 137

Query: 62  EQITCTAALVGSYNWRKVIIIYEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYL 121
           +      AL   ++W +  ++Y DD    +      L    ++   E  +  +       
Sbjct: 138 KMGEMMLALFRHHHWSRAALVYSDDK--LERNCYFTLEGVHEVFQEEGLHTSIYSFDETK 195

Query: 122 TDPKQFLQEKLLKLLRTESRVFIILQSSLAMGIHLFREAKEMGLVGPDSVWVI------- 174
               + +           S   +I+ +S      +   A   G+   D  +         
Sbjct: 196 DLDLEDIVRN-----IQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSS 250

Query: 175 ---------------ASDTITSALGIKTHFSQDSSSYKIFEDQFRSYFRSEYPEDDVSEP 219
                           +    S+L   T        ++ F  + +S    +   +     
Sbjct: 251 SYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVE-KQGLNMEDYV 309

Query: 220 GIYALRAYDSITVVAKSIDGMTSDNSSSKIS---LGYILSSNFTGLSGPISF--RGGKLL 274
            ++    +D+I +   ++  +     S K     +    +  F G++G +S    G +  
Sbjct: 310 NMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYG 369

Query: 275 NSPILRIINMVGKKYKEIDFWLPKFGLSKTLKM 307
           +  ++ + ++     + I  +   FG     +M
Sbjct: 370 DFSVIAMTDVEAGTQEVIGDY---FGKEGRFEM 399
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Length = 238 Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Length = 248 Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 99.97
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 99.95
d1qo0a_373 Amide receptor/negative regulator of the amidase o 99.93
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.89
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.89
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.88
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.86
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.84
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.84
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 99.82
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.8
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.75
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 96.88
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.74
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 95.71
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 95.0
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 92.94
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 92.34
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 91.96
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 91.9
d2fvya1305 Galactose/glucose-binding protein {Escherichia col 91.48
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 91.22
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 91.13
d8abpa_305 L-arabinose-binding protein {Escherichia coli [Tax 91.0
d1guda_288 D-allose-binding protein {Escherichia coli [TaxId: 90.42
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 80.24
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.7e-35  Score=327.69  Aligned_cols=282  Identities=17%  Similarity=0.238  Sum_probs=227.2

Q ss_pred             ccceEEEEcCCChhhHHHHHHhccCCCccEEeeeCCCCCCCCCC-CCCCeEEEecCChHHHHHHHHHHHhhcCceEEEEE
Q 003821            4 EKEVKVIVGMETWGAATMVADIGSRAQVPVLSFAEPAIAPPLTS-TRWPFLVRMANSSAEQITCTAALVGSYNWRKVIII   82 (793)
Q Consensus         4 ~~~V~aiiGp~~s~~~~~va~i~~~~~iP~Is~~~~~~~~~l~~-~~~~~~~r~~p~~~~~~~ai~~ll~~~~w~~vaii   82 (793)
                      ..+|+|||||.+|.++.+++.++..++||+||++++  ++.|++ ..||+|+|+.|++..|++|+++++++|||++|++|
T Consensus       118 ~~~v~aviGp~~s~~s~~va~~~~~~~iP~IS~~at--s~~lsd~~~yp~f~Rt~psd~~~~~ai~~ll~~f~W~~V~vi  195 (477)
T d1ewka_         118 KKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSAT--SIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAV  195 (477)
T ss_dssp             -CCEEEEECCSSHHHHHHHHHHHGGGTCCEEESSCC--CGGGGCTTTCTTEEESSCCHHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             ccceEEEECCCcchhHHHHHHHhhhccCceeccccC--CccccccccCCceEEecccchhhHHHHHHHHHHcCCcEEEEE
Confidence            357999999999999999999999999999999999  899975 67999999999999999999999999999999999


Q ss_pred             EEcCCCccccccHHHHHHHHHhcCceeeEEeecCCCCCCCCChHHHHHHHHHhhcC--CceEEEEeccChHHHHHHHHHH
Q 003821           83 YEDDATNADTGNLALLSEALQISNSEIEYRLVLPPISYLTDPKQFLQEKLLKLLRT--ESRVFIILQSSLAMGIHLFREA  160 (793)
Q Consensus        83 ~~dd~~G~~~~~~~~l~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~l~~l~~~--~~~vivvl~~~~~~~~~~l~~a  160 (793)
                      |++|+||  ..+.+.|++++++.|+||.....++...    ...++...+++++++  .++|||+ ++....+..++++|
T Consensus       196 ~~~d~~g--~~~~~~l~~~~~~~~i~v~~~~~i~~~~----~~~~~~~~l~~l~~~~~~~rVIv~-~~~~~~~~~ll~~a  268 (477)
T d1ewka_         196 HTEGNYG--ESGMDAFKELAAQEGLCIAHSDKIYSNA----GEKSFDRLLRKLRERLPKARVVVC-FCEGMTVRGLLSAM  268 (477)
T ss_dssp             EESSHHH--HHHHHHHHHHHHHHTCEEEEEEEECTTC----CHHHHHHHHHHHHTTTTTCCEEEE-ECCHHHHHHHHHHH
T ss_pred             EecchhH--HHHHHHHHHHHHHcCcEEEEEeeccCCC----chhhHHHHHHHHhhhccCceEEEE-ecCHHHHHHHHHHH
Confidence            9999999  9999999999999999999888876543    346789999999876  7899888 89999999999999


Q ss_pred             HHcCCCCCCeEEEEeCCcccc--------------ceeecccccCCchhhh---------------HHHHHHHHhhhhcC
Q 003821          161 KEMGLVGPDSVWVIASDTITS--------------ALGIKTHFSQDSSSYK---------------IFEDQFRSYFRSEY  211 (793)
Q Consensus       161 ~~~g~~~~~~~wi~~~~~~~~--------------~~g~~~~~~~~~~~~~---------------~f~~~~~~~~~~~~  211 (793)
                      .++||.++ +.|+.+ ++...              .+++....... +.++               .|.+-|++.|++..
T Consensus       269 ~~~g~~g~-~~~i~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i-~~f~~~~~~~~~~~~~~n~~~~~~w~~~f~c~~  345 (477)
T d1ewka_         269 RRLGVVGE-FSLIGS-DGWADRDEVIEGYEVEANGGITIKLQSPEV-RSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRL  345 (477)
T ss_dssp             HHHTCCSC-CEEEEC-TTTTTCHHHHTTCHHHHTTCEEEEECCCCC-HHHHHHHTTCCTTTCCSCTTHHHHHHHHTTCBC
T ss_pred             HHcCccCC-ceEEEe-cccccchhhccccccccCcceEeeeccccc-hhHHHHHHhcCcccCCCChHHHHHHHHHhCCCc
Confidence            99999976 557776 44332              22222221111 2222               24445666776543


Q ss_pred             CCCC------------------CCCcchhhHhHhHHHHHHHHHHhhccC-------------CCCChhhHHHhhhhcccc
Q 003821          212 PEDD------------------VSEPGIYALRAYDSITVVAKSIDGMTS-------------DNSSSKISLGYILSSNFT  260 (793)
Q Consensus       212 ~~~~------------------~~~~~~~a~~~YDAv~~la~Al~~~~~-------------~~~~g~~l~~~l~~~~f~  260 (793)
                      +...                  ...+..+++++||||+++|+||+++..             .+.+|..|++.|++++|.
T Consensus       346 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yDAV~a~A~AL~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~v~F~  425 (477)
T d1ewka_         346 PGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFV  425 (477)
T ss_dssp             TTCTTCCTTCCSBCCSCCCTTTTCCCCTTHHHHHHHHHHHHHHHHHHHHHHSTTCSSCCGGGSSCCHHHHHHHHHTCEEE
T ss_pred             ccccccCccccccccchhhcccccccchHHHHHHHHHHHHHHHHHHHHHhhCCCCCCcccCCCcCCHHHHHHHHhcCeeE
Confidence            2211                  012245788999999999999998632             124789999999999999


Q ss_pred             ccee-eEEEeCCCcCCCCcEEEEEeec-----ceeEEEEEecCC
Q 003821          261 GLSG-PISFRGGKLLNSPILRIINMVG-----KKYKEIDFWLPK  298 (793)
Q Consensus       261 G~tG-~i~Fd~~g~~~~~~~~I~~~~~-----~~~~~VG~w~~~  298 (793)
                      |++| .|.||++|++ ...|+|++++.     .++++||.|++.
T Consensus       426 G~tG~~v~Fd~nGd~-~~~y~I~n~q~~~~~~~~~~~VG~w~~~  468 (477)
T d1ewka_         426 GVSGEEVWFDEKGDA-PGRYDIMNLQYTEANRYDYVHVGTWHEG  468 (477)
T ss_dssp             CTTSCEEECCTTSCC-CCCEEEEEEEECSSSCEEEEEEEEEETT
T ss_pred             CCCCCEEEECCCCCc-cceEEEEEEEECCCCcEEEEEEEEEeCC
Confidence            9999 5999999997 57899998863     247999999864
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure