Citrus Sinensis ID: 003854

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-
MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDGFGPQHVSDAALSARLNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDRHALIVPPYMGHGNRVHPMPFADPSTPLQPRPMVPQKDIAVYGYGSVAWKDRMEEWKKRQNEKLQVVKHEGGSDSRNFDGGELDDSDLPMMDEGRQPLSRKLPIPSSKISPYRLIIILRLVILGLFFHYRILHPVNNAYALWLTSVICEIWFGVSWILDQFPKWYPITRETYLDRLSLRYEKEGKPSQLAKVDIFVSTVDPMKEPPLITANTVLSILAVDYPVDKVACYVSDDGAAMLTFEALSETSEFARKWVPFCKKFNIEPRAPEWYFSQKIDYLRNKVHPAFVRERRAIKREYEEFKIRINALVATAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQVFLGQSGVRDVEGNELPSLVYVSREKRPGFEHHKKAGAMNALVRVSAVLSNAPYLLNVDCDHYINNSKALREAMCFMMDPQSGKKICYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGYDAPVKKKSPGKTCNCWPKWCCLCCGSRKNKKAKQPKKDKKKKSKNKEASKQIHALENIEEGVEETNAEKPSDMSRMKLEKKFGQSPVFVDSSLLEDGGVTGDLKRASLLKEAIQVISCGYEDKTEWGKEVSWLDIWFCD
cccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccCEECccccHHHHHHHHHcccccccccccccEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHccccccccEEEECcccccccHHHHHHHHccccccccccccEEEEccccCCccccccccccccccEEEccccccccccccccEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHcccccHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccEEEEEccc
****GRLIAGSHNRNEFVLINADETARIKSV*ELSGQTCQICEDEIEITDNGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKR*K************DIDDLDHEFDYGNL***************************************************************************************QKDIAVYGYGSVAWKDRM***********************************************KLPIPSSKISPYRLIIILRLVILGLFFHYRILHPVNNAYALWLTSVICEIWFGVSWILDQFPKWYPITRETYLDRLSLRYEKEGKPSQLAKVDIFVSTVDPMKEPPLITANTVLSILAVDYPVDKVACYVSDDGAAMLTFEALSETSEFARKWVPFCKKFNIEPRAPEWYFSQKIDYLRNKVHPAFVRERRAIKREYEEFKIRINALVATAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQVFLGQSGVRDVEGNELPSLVYVSREKRPGFEHHKKAGAMNALVRVSAVLSNAPYLLNVDCDHYINNSKALREAMCFMMDPQSGKKICYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGYDAPVKKKSPGKTCNCWPKWCCLCCG*********************************************************GQSPVFVDSSLLEDGGVTGDLKRASLLKEAIQVISCGYEDKTEWGKEVSWLDIWFCD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDGFGPQHVSDAALSARLNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDRHALIVPPYMGHGNRVHPMPFADPSTPLQPRPMVPQKDIAVYGYGSVAWKDRMEEWKKRQNEKLQVVKHEGGSDSRNFDGGELDDSDLPMMDEGRQPLSRKLPIPSSKISPYRLIIILRLVILGLFFHYRILHPVNNAYALWLTSVICEIWFGVSWILDQFPKWYPITRETYLDRLSLRYEKEGKPSQLAKVDIFVSTVDPMKEPPLITANTVLSILAVDYPVDKVACYVSDDGAAMLTFEALSETSEFARKWVPFCKKFNIEPRAPEWYFSQKIDYLRNKVHPAFVRERRAIKREYEEFKIRINALVATAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQVFLGQSGVRDVEGNELPSLVYVSREKRPGFEHHKKAGAMNALVRVSAVLSNAPYLLNVDCDHYINNSKALREAMCFMMDPQSGKKICYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGYDAPVKKKSPGKTCNCWPKWCCLCCGSRKNKKAKQPKKDKKKKSKxxxxxxxxxxxxxxxxxxxxxNAEKPSDMSRMKLEKKFGQSPVFVDSSLLEDGGVTGDLKRASLLKEAIQVISCGYEDKTEWGKEVSWLDIWFCD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cellulose synthase A catalytic subunit 6 [UDP-forming] Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. Involved in the primary cell wall formation. The presence of each protein CESA1 and CESA6 is critical for cell expansion. The hypocotyl elongation is based on a CESA6-dependent cell elongation in dark and a CESA6-independent cell elongation in light. The transition between these two mechanisms requires photosynthesis and PHYB, but not CRY1. The CESA6-dependent cell elongation seems to be independent of gibberellic acid, auxin and ethylene. May be involved in sensitivity to isoxaben. Associates with and moves along cortical microtubules for the process of cellulose deposition.probableQ94JQ6
Probable cellulose synthase A catalytic subunit 5 [UDP-forming] Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.probableQ851L8
Probable cellulose synthase A catalytic subunit 3 [UDP-forming] Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.probableQ69V23

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.12Cellulose synthase (UDP-forming).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WEO, chain A
Confidence level:very confident
Coverage over the Query: 28-111
View the alignment between query and template
View the model in PyMOL
Template: 4HG6, chain A
Confidence level:confident
Coverage over the Query: 282-412,452-481,528-655
View the alignment between query and template
View the model in PyMOL