Citrus Sinensis ID: 003899

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVTDEEHDQQQPESPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASSDSS

cHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHccEEEcccccccccccccccccEEEEEECcccccccccccccccccccEEEEcccccccccHHHHHHHHHHcccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccEEEEcccccccccHHcccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEcccccccccHHHHHcccccccccccEEEEEcccccccccccHHHHHHHcccccccccccEEEEccccccccccccccccccEEEEEEccccccccccccccccccEEEEccccccEECcccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccEEEccccccHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEECcccccccccccccccccccEEEEEEcccccccccccccccEEEECccccccccccccccccccEEEEECcccccccccccccccccccEEEEccccccccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEccccc

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVT**********SPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 115-213,260-279,290-417
View the alignment between query and template
View the model in PyMOL

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 140-227,239-241,267-272,292-427
View the alignment between query and template
View the model in PyMOL

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 302-367,404-465,489-711
View the alignment between query and template
View the model in PyMOL

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 142-237,266-279,290-596
View the alignment between query and template
View the model in PyMOL

Template: 1M9S, chain A
Confidence level:very confident
Coverage over the Query: 84-223
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 118-228,258-279,290-367,394-430,441-545,578-712
View the alignment between query and template
View the model in PyMOL

Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 60-537
View the alignment between query and template
View the model in PyMOL

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 118-228,259-274,309-775
View the alignment between query and template
View the model in PyMOL

Template: 2A5Y, chain B
Confidence level:probable
Coverage over the Query: 1-47
View the alignment between query and template
View the model in PyMOL