Citrus Sinensis ID: 003899

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVTDEEHDQQQPESPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASSDSS

cHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHccEEEcccccccccccccccccEEEEEEEcccccccccccccccccccEEEEcccccccccHHHHHHHHHHcccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccEEEEcccccccccHHcccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEcccccccccHHHHHcccccccccccEEEEEcccccccccccHHHHHHHcccccccccccEEEEccccccccccccccccccEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccEEEccccccHHHHHHHHHcccccccEEEEEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEcccccccccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccccEEEEccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEccccc

ccHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEEcccccccccccHHHHHHHccEEEEccccccccccHHHHHHHHHHHHccEEEEEcccccccccccccHHccHHEEEEEcccccccccccHHHHHHHHHHHHHcccHHHHHccHHHHcccccEEEEccccccHccccccccccHcccEccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHcHcccccccEEEEEEcccccccccccHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEEcccccccccccccccccEEEEcccccEEEccHHHcccccccccccHcEEEEcccHHHHHHcccccccccccccccHcEEEEccccHHcccccccccccEEEEEcccccccccccccccccEEEEcccccEEEccccccccccEEEEEcccccccHHHHcccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEcEccccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHcccccccccccEEEEccccccccccccccccccEEEEEcccHHHHHccHHcccccccccEEEEccccccccccccccccccEEEEcccHcHHcccccccccccHHEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEccccc

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFsyicgesdgekrlqsvcdvehlrtflpvnlsnyrINYLAWSVLQMLmnlprlrvfslhgysniielPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLkssnvdsleempkgfgKLTCLLTlgtfvvgkdggsglrELKSLTHlqgtlqisklenvkdVGDACEAQLNSKENLQALLLKWStrdvqnldqcefETHVLSvlkphqdvqeltitgyggtkfpiwlgdssfsKLARLELcrctstslpsvgqlpflmeldisgmdgvksvgsefyrrscsvpfpsletlsfsdmreweewipcgagqevdeVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQclpalselqidgcervvfsspidlsslksVHLAYVANEVVLAGLFeqglpklenLVIVEVREQAYLWQSETRLLQDIRSLNrlhisrcprllslvtdeehdqqqpespyrlRFLELKIFIYDLenlqslpagLHNLRHLQKIWiskcpnlesfpeeglpsaklTELMIWRCENLKALPNSMSSLLRLgiigcpslesfpedgfptnlqslevrdlkitKPLLewglnrftslrnlsigggypdllssppfpasltelwisdmpdleclSSISENLTSLEflylidcpklkyfpeqglpkslsrlsihncpliekrcrkdegkywpmishiphfnassdss

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTstslpsvgqlPFLMELDISGMDGVKSVGSEFyrrscsvpfpsLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSlvtdeehdqqqpespyrLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMIShiphfnassdss

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHklqgklpkrlllletlVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVTDEEHDQQQPESPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASSDSS

**************************RFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHL**********MPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVT************YRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPH********

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEG*N*QKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRD**********THVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVT**********SPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASS***

MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQKFCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVT**********SPYRLRFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSMSSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPPFPASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIPHFNASSDSS

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		788	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.545	0.407	0.398	4e-75
Q9LRR5		1424	Putative disease resistan	no	no	0.545	0.301	0.384	1e-69
Q7XA39		988	Putative disease resistan	N/A	no	0.649	0.518	0.302	3e-46
Q7XBQ9		970	Disease resistance protei	N/A	no	0.623	0.506	0.305	2e-36
Q7XA42		979	Putative disease resistan	N/A	no	0.546	0.440	0.309	2e-35
Q7XA40		992	Putative disease resistan	N/A	no	0.668	0.531	0.294	6e-34
Q38834		852	Disease resistance RPP13-	no	no	0.385	0.356	0.269	6e-09
Q9STE7		847	Putative disease resistan	no	no	0.228	0.212	0.294	2e-07
O81825		919	Probable disease resistan	no	no	0.5	0.428	0.256	2e-07
P0CB16		1201	Putative disease resistan	no	no	0.587	0.385	0.242	9e-07

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  283 bits (724), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 181/454 (39%), Positives = 260/454 (57%), Gaps = 24/454 (5%)

Query: 1   MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQK 60
           +E LG E+  EL SRSL Q   K  +R++MHD IN+LA +A+GE   + +D      + +
Sbjct: 466 LEELGNEYFSELESRSLLQ---KTKTRYIMHDFINELAQFASGEFSSKFEDGC----KLQ 518

Query: 61  FCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNLSNY-RINYLAWSVLQMLM-NLP 118
             +  R+ SY+          +++ +V+ LRTFLP++L+N  R   L   V + L+  L 
Sbjct: 519 VSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLT 578

Query: 119 RLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQL 178
           RLRV SL  Y      P+  +N+ H RFL+LSRT ++ LP+S+  +YNL T+LL  C  L
Sbjct: 579 RLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSL 638

Query: 179 KKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLT 238
           K+L  D+ NL  LR+L       L +MP+ FG+L  L TL TF V    GS + EL  L 
Sbjct: 639 KELPTDISNLINLRYLDLIGT-KLRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLH 697

Query: 239 HLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKW-----STRDVQNLDQCEFETHV 293
            L G L+I +L+ V DV DA EA LNSK++L+ +   W     S+ +  N  + + E  V
Sbjct: 698 DLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEV 757

Query: 294 LSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTS-TSLPSVGQLPFLME 352
              L+PH+ +++L I  Y G +FP WL D SFS++  + L  C   TSLPS+GQLP L E
Sbjct: 758 FEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKE 817

Query: 353 LDISGMDGVKSVGSEFY------RRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEV 406
           L ISGM G++S+G +FY      R     PF SLETL F ++ +W+EW+     +   ++
Sbjct: 818 LHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTR--GDL 875

Query: 407 FPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSC 440
           FP L+KL +  C +L G LP  L  L +L I  C
Sbjct: 876 FPSLKKLFILRCPELTGTLPTFLPSLISLHIYKC 909

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q9STE7\|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1	Back alignment and function description

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		788
359495083		1280	PREDICTED: putative disease resistance p	0.949	0.584	0.412	1e-133
225449872		1322	PREDICTED: putative disease resistance p	0.979	0.583	0.391	1e-132
359495085		1345	PREDICTED: putative disease resistance p	0.965	0.565	0.386	1e-132
359487257		1330	PREDICTED: putative disease resistance p	0.961	0.569	0.396	1e-131
225465962		1290	PREDICTED: putative disease resistance R	0.960	0.586	0.410	1e-131
359487247		1944	PREDICTED: putative disease resistance p	0.965	0.391	0.394	1e-131
147825318		1824	hypothetical protein VITISV_003723 [Viti	0.961	0.415	0.396	1e-130
359495052		1324	PREDICTED: putative disease resistance p	0.973	0.579	0.394	1e-130
359487416		1472	PREDICTED: putative disease resistance p	0.973	0.521	0.366	1e-129
147846228		1372	hypothetical protein VITISV_006043 [Viti	0.979	0.562	0.370	1e-129

>gi\|359495083\|ref\|XP_003634908.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  483 bits (1244), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 338/819 (41%), Positives = 468/819 (57%), Gaps = 71/819 (8%)

Query: 1    MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQK 60
            +E  G      L SRS FQQ+S D S F+MHDLI+DLA + +G+ C  +DD    E + +
Sbjct: 476  IEDYGNMCFDNLLSRSFFQQASDDESIFLMHDLIHDLAQFVSGKFCSSLDD----EKKSQ 531

Query: 61   FCQSLRHFSYICGES-DGEKRLQSVCDVEHLRTFLPVNLSN-YRINYLAWSVLQMLM-NL 117
              +  RH SY+  E  +  K+     +  +LRTFLPV+  + Y   +L+  V  +L+  L
Sbjct: 532  ISKQTRHSSYVRAEQFELSKKFDPFYEAHNLRTFLPVHTGHQYGRIFLSKKVSDLLLPTL 591

Query: 118  PRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQ 177
              LRV SL  Y +I+ELP+ I  LKHLR+L+LSRTSI+ LPESI +L+NL T++L +C  
Sbjct: 592  KCLRVLSLAHY-HIVELPHSIGTLKHLRYLDLSRTSIRRLPESITNLFNLQTLMLSNCIS 650

Query: 178  LKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSL 237
            L  L  +MG L  L+HL  +N   L+EMP G   L  L TL  FVVG+D G+ ++EL+ +
Sbjct: 651  LTHLPTEMGKLINLQHLDITNT-ILKEMPMGMKGLKRLRTLTAFVVGEDRGAKIKELRDM 709

Query: 238  THLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKW----STRDVQNLDQCEFETHV 293
            +HL G L ISKL+NV D  D  EA L  KE L  L+++W    + RD+Q       ET V
Sbjct: 710  SHLGGRLCISKLQNVVDAMDVFEANLKGKERLDELVMQWDGEATARDLQK------ETTV 763

Query: 294  LSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTS-TSLPSVGQLPFLME 352
            L  L+PH +++ELTI  Y G KFP WL + SF+ +  ++L  C + +SLPS+GQL  L E
Sbjct: 764  LEKLQPHNNLKELTIEYYCGEKFPNWLSEHSFTNMVSMQLHDCKNCSSLPSLGQLGSLKE 823

Query: 353  LDISGMDGVKSVGSEFYRR---SCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPK 409
            L I  +DGV+ VG EFY     S   PF +LE L F +M EWEEW+ C   +E++  FP 
Sbjct: 824  LSIMRIDGVQKVGQEFYGNIGSSSFKPFEALEILRFEEMLEWEEWV-C---REIE--FPC 877

Query: 410  LRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCERVVFSSP 469
            L++L +  C KL+  LPK L  L  L I+ C+QL+  +   P++ +L+++ C+ VV  S 
Sbjct: 878  LKELYIKKCPKLKKDLPKHLPKLTKLEIRECKQLVCCLPMAPSIRKLELEKCDDVVVRSA 937

Query: 470  IDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRS-- 527
              L+SL S+ ++ V       G     L +L  L   E++E   +  + T L +D++   
Sbjct: 938  GSLTSLASLDISNVCKIPDELGQL-HSLVELYVLFCPELKEIPPILHNLTSL-KDLKVEN 995

Query: 528  ---------------LNRLHISRCPRLLSLVTDEEHDQQQPESPYRLRFLELK-IFIYDL 571
                           L  L I  CP L SL          PE      F +L+ + +++ 
Sbjct: 996  CESLASFPEMALPPMLESLQIFSCPILESL----------PEGMIA-SFTKLETLHLWNC 1044

Query: 572  ENLQSL--PAGLH--NLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPN 627
             NL+SL    GLH  +L  LQ + I  CPNL SFP  GLP+  L  L I+ CE LK+LP 
Sbjct: 1045 TNLESLYIRDGLHHMDLTSLQSLDIWNCPNLVSFPRGGLPTPNLRWLGIYNCEKLKSLPQ 1104

Query: 628  SM----SSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDL-KITKPLLEWGLNRFTSLRN 682
             M    +SL  L I GCP ++SFPE G PTNL SL + +  K+    +EWGL     LR 
Sbjct: 1105 GMHTLLTSLELLTIEGCPEIDSFPEGGLPTNLSSLYIVNCNKLLACRMEWGLQTLPFLRT 1164

Query: 683  LSIGGGYPDLLSSPPF-PASLTELWISDMPDLECLSSIS-ENLTSLEFLYLIDCPKLKYF 740
            L IGG   +      F P++LT L I   P+L+ L +   ++LTSLE L +  C  LK F
Sbjct: 1165 LQIGGYEKERFPEERFLPSTLTSLEIRGFPNLKSLDNKGLQHLTSLETLEIWKCGNLKSF 1224

Query: 741  PEQGLPKSLSRLSIHNCPLIEKRCRKDEGKYWPMISHIP 779
            P+QGLP SLSRL I  CPL+ KRC++D+GK WP ISHIP
Sbjct: 1225 PKQGLPSSLSRLYIGECPLLRKRCQRDKGKEWPKISHIP 1263

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225449872\|ref\|XP_002265429.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495085\|ref\|XP_003634909.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487257\|ref\|XP_002269571.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225465962\|ref\|XP_002269685.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487247\|ref\|XP_003633546.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147825318\|emb\|CAN73260.1\| hypothetical protein VITISV_003723 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495052\|ref\|XP_002267579.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487416\|ref\|XP_002272889.2\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147846228\|emb\|CAN81660.1\| hypothetical protein VITISV_006043 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		788
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.517	0.286	0.393	4.4e-96
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.516	0.386	0.401	2.9e-78
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.384	0.168	0.273	5.6e-27
TAIR\|locus:2094498		1981	AT3G25510 [Arabidopsis thalian	0.392	0.155	0.250	1.7e-10
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.247	0.160	0.300	6.9e-09
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.384	0.355	0.283	2.5e-12
TAIR\|locus:2098110		1219	AT3G44670 [Arabidopsis thalian	0.244	0.158	0.296	1.3e-10
TAIR\|locus:2026634		992	AT1G63740 [Arabidopsis thalian	0.215	0.171	0.294	1e-09
UNIPROTKB\|A6QLV3		582	SHOC2 "Leucine-rich repeat pro	0.252	0.341	0.262	1e-09
UNIPROTKB\|Q9UQ13		582	SHOC2 "Leucine-rich repeat pro	0.252	0.341	0.262	1e-09

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 681 (244.8 bits), Expect = 4.4e-96, Sum P(2) = 4.4e-96
 Identities = 169/430 (39%), Positives = 237/430 (55%)

Query:     1 MEGLGREFVRELHSRSLFQQSSKDASRFVMHDLINDLAWWAAGEMCFRMDDTLEGENRQK 60
             +E +G +++ +L ++S FQ+     + FVMHDL+NDLA   +G+ CFR++D    +N  +
Sbjct:   458 LEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLED----DNIPE 513

Query:    61 FCQSLRHFSYICGESDGEKRLQSVCDVEHLRTFLPVNL-SNYRINYLAWSVLQMLMN-LP 118
                + RHFS+   + D     +S+C  E LRT LP N  ++     L   VL  L+N L 
Sbjct:   514 IPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALS 573

Query:   119 RLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQL 178
              LR+ SL  Y  I  LP  ++ LK LR+L+LS T I+ LPE + +L NL T+LL +C  L
Sbjct:   574 GLRILSLSHYQ-ITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDL 632

Query:   179 KKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLT 238
               L   +  L  LR L       L EMP G  KL  L  L  FV+G+  G+GL ELK L+
Sbjct:   633 TSLPKSIAELINLRLLDLVGTP-LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELS 691

Query:   239 HLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQ------NLDQCEFETH 292
             HL+GTL+IS+L+NV    +A +A L  K  L  L+LKW+ +         N   C+ +  
Sbjct:   692 HLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACD-QKE 750

Query:   293 VLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCT-STSLPSVGQLPFLM 351
             VL +L+PH  ++   I  Y G  FP WLGDSSF  +  + L  C    SLP VGQLP L 
Sbjct:   751 VLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLK 810

Query:   352 ELDISGMDGVKSVGSEFY---RRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFP 408
              L I   + ++ VG +F+     S  VPF SL+ L F  M  W+EWI C   +  D +FP
Sbjct:   811 YLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWI-CPELE--DGIFP 867

Query:   409 KLRKLSLFNC 418
              L+KL +  C
Sbjct:   868 CLQKLIIQRC 877

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2026634 AT1G63740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		788
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	5e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.003

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 63.7 bits (155), Expect = 3e-10
 Identities = 59/194 (30%), Positives = 90/194 (46%), Gaps = 11/194 (5%)

Query: 572 ENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPN--SM 629
           +NL+ +P  L    +L+ + +S C +L   P       KL +L + RCENL+ LP   ++
Sbjct: 645 KNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINL 703

Query: 630 SSLLRLGIIGCPSLESFPEDGFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGY 689
            SL RL + GC  L+SFP+    TN+  L++ +  I +      L     L    +    
Sbjct: 704 KSLYRLNLSGCSRLKSFPD--ISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEK 761

Query: 690 PDLLSSPPFP------ASLTELWISDMPDLECLSSISENLTSLEFLYLIDCPKLKYFPEQ 743
                 P  P       SLT L++SD+P L  L S  +NL  LE L + +C  L+  P  
Sbjct: 762 LWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTG 821

Query: 744 GLPKSLSRLSIHNC 757
              +SL  L +  C
Sbjct: 822 INLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		788
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.96
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.96
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.95
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.91
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.91
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.89
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.89
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.6
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.6
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.54
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.51
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.49
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.48
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.46
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.45
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.41
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.09
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.06
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.01
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.89
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.85
PRK15386		426	type III secretion protein GogB; Provisional	98.84
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.81
KOG4341		483	consensus F-box protein containing LRR [General fu	98.79
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.75
KOG4341		483	consensus F-box protein containing LRR [General fu	98.73
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.64
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.64
PRK15386		426	type III secretion protein GogB; Provisional	98.62
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.62
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.53
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.5
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.46
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.43
PLN03150		623	hypothetical protein; Provisional	98.42
PLN03150		623	hypothetical protein; Provisional	98.42
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.32
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.25
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.23
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.19
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.17
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.15
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.09
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.97
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.74
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.68
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.56
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.52
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.51
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.49
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.46
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.33
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.32
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.01
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.88
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.87
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.86
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.78
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.72
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.51
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.89
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.5
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.14
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.14
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.57
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.55
KOG0473		326	consensus Leucine-rich repeat protein [Function un	94.36
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.89
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.84
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.52
smart00370		26	LRR Leucine-rich repeats, outliers.	92.13
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	92.13
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.01
smart00370		26	LRR Leucine-rich repeats, outliers.	88.22
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	88.22
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	82.01

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=4.7e-39  Score=385.76  Aligned_cols=525  Identities=18%  Similarity=0.197  Sum_probs=285.2

Q ss_pred             CceeEEEeccCCccccchhhhhHHHHhCCCCCeeEEEccCCcCcc-cccccc-cCCCCCceeeccCCccc-ccchhhhcc
Q 003899           88 EHLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNII-ELPNEI-ENLKHLRFLNLSRTSIQ-ILPESINSL  164 (788)
Q Consensus        88 ~~Lr~L~~~~~~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~l~-~lp~~~-~~l~~L~~L~L~~~~i~-~lp~~i~~L  164 (788)
                      .+++.|.+.++.      +.+.++..|..+++|++|+|++| .+. .+|..+ ..+.+||+|+|++|++. .+|.  +.+
T Consensus        69 ~~v~~L~L~~~~------i~~~~~~~~~~l~~L~~L~Ls~n-~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l  139 (968)
T PLN00113         69 SRVVSIDLSGKN------ISGKISSAIFRLPYIQTINLSNN-QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSI  139 (968)
T ss_pred             CcEEEEEecCCC------ccccCChHHhCCCCCCEEECCCC-ccCCcCChHHhccCCCCCEEECcCCccccccCc--ccc
Confidence            456666666542      33444556777888888888887 554 677554 47788888888888776 3453  457


Q ss_pred             ccCcEEEccCccchhhchhhhhcccCCceEecCCCcCcccCCccCcCCCCcceeCceEeCCCCCCCcccccccccCCcee
Q 003899          165 YNLNTILLEDCYQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTL  244 (788)
Q Consensus       165 ~~L~~L~L~~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~p~~i~~l~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~l  244 (788)
                      ++|++|++++|.....+|..++.+++|++|++++|.....+|..++++++|++|++.++...+                 
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~-----------------  202 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVG-----------------  202 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcC-----------------
Confidence            788888888874444677778888888888888877455677777777777777764432210                 


Q ss_pred             EEeccCCCCCchhhhhcccCCCcCCceEEEEeecCcccCccchhhhhhhcccCccccccceEEEEeeCCC-CCCcccCCC
Q 003899          245 QISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGT-KFPIWLGDS  323 (788)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~~~~~  323 (788)
                                   .....+.++++|+.|+++++..          ....+..+..+++|+.|++++|... .+|..+.  
T Consensus       203 -------------~~p~~l~~l~~L~~L~L~~n~l----------~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~--  257 (968)
T PLN00113        203 -------------QIPRELGQMKSLKWIYLGYNNL----------SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG--  257 (968)
T ss_pred             -------------cCChHHcCcCCccEEECcCCcc----------CCcCChhHhcCCCCCEEECcCceeccccChhHh--
Confidence                         0001122333444444444332          1122233334445555555444332 2333332  


Q ss_pred             CCCCeeEEEECCCCC-CCCCC-CCCCCCccEEEecCCCCceEeCcccccCCCCCCCCCcceEecccccccccccccCCCC
Q 003899          324 SFSKLARLELCRCTS-TSLPS-VGQLPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQ  401 (788)
Q Consensus       324 ~~~~L~~L~L~~~~~-~~l~~-l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~  401 (788)
                      .+++|+.|++++|.+ ..+|. +..+++|++|++++|.....++.                                   
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~-----------------------------------  302 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE-----------------------------------  302 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh-----------------------------------
Confidence            344444444444444 33332 44444444444444432211111                                   


Q ss_pred             cccccCCcccEEeeecCcccccCCCCCCCCccEEEEeccCCcccccCCCCCccEEEeccCCc--ceecCCcCCCCccEEe
Q 003899          402 EVDEVFPKLRKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQLLVTIQCLPALSELQIDGCER--VVFSSPIDLSSLKSVH  479 (788)
Q Consensus       402 ~~~~~~~~L~~L~l~~c~~l~~~lp~~l~~L~~L~l~~c~~l~~~~~~~~~L~~L~l~~~~~--~~~~~~~~~~~L~~L~  479 (788)
                       ....+++|+.|++++| .+.+.+|.                  .+..+++|+.|++++|..  .....+..+++|+.|+
T Consensus       303 -~~~~l~~L~~L~l~~n-~~~~~~~~------------------~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~  362 (968)
T PLN00113        303 -LVIQLQNLEILHLFSN-NFTGKIPV------------------ALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLD  362 (968)
T ss_pred             -hHcCCCCCcEEECCCC-ccCCcCCh------------------hHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEE
Confidence             1122344444444444 22222221                  122233333334333331  1112223344444444


Q ss_pred             ccccccceeeccccccCCCCccEEEEecCcccchhhhcccccccCCCCCCeEEcccCCCccccccCccccccCCCCcccc
Q 003899          480 LAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSLVTDEEHDQQQPESPYRL  559 (788)
Q Consensus       480 l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~l  559 (788)
                      +++|.....+|.. +..+++|+.|++++|.....+    +..+..+++|+.|++++|...                    
T Consensus       363 Ls~n~l~~~~p~~-~~~~~~L~~L~l~~n~l~~~~----p~~~~~~~~L~~L~L~~n~l~--------------------  417 (968)
T PLN00113        363 LSTNNLTGEIPEG-LCSSGNLFKLILFSNSLEGEI----PKSLGACRSLRRVRLQDNSFS--------------------  417 (968)
T ss_pred             CCCCeeEeeCChh-HhCcCCCCEEECcCCEecccC----CHHHhCCCCCCEEECcCCEee--------------------
Confidence            4444333333332 233455555665555554444    455555555555555554321                    


Q ss_pred             cceEEEEEecCccCcccccccccCCCCcceEEEecCCCCcccCCCCCCCCcccEEEeccccccccccccc--CccceEec
Q 003899          560 RFLELKIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCENLKALPNSM--SSLLRLGI  637 (788)
Q Consensus       560 ~~L~L~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~--~~L~~L~l  637 (788)
                                     ..+|..+..+++|+.|++++|.....+|.....+++|+.|++++|.....+|..+  .+|+.|++
T Consensus       418 ---------------~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~l  482 (968)
T PLN00113        418 ---------------GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDL  482 (968)
T ss_pred             ---------------eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEEC
Confidence                           1223334445555566665544333444444445556666666655554444432  25666666


Q ss_pred             cCCCCCCCCCCC-CCCCCccEEEEeccCCCCcccccccCCCCCccEEEEcCCCCCcccCCC---CCCCCCeEecCCCCCc
Q 003899          638 IGCPSLESFPED-GFPTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPP---FPASLTELWISDMPDL  713 (788)
Q Consensus       638 ~~c~~l~~~~~~-~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~---~~~~L~~L~l~~~~~l  713 (788)
                      ++|.-...+|.. .-.++|+.|++++|...+.++. .+.++++|++|++++ |.-...+|.   .+++|+.|+|++|...
T Consensus       483 s~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~-~~~~l~~L~~L~Ls~-N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        483 SRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPD-ELSSCKKLVSLDLSH-NQLSGQIPASFSEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             cCCccCCccChhhhhhhccCEEECcCCcceeeCCh-HHcCccCCCEEECCC-CcccccCChhHhCcccCCEEECCCCccc
Confidence            665433333322 1235777788877766554443 577788888888888 444445555   5678888888887666


Q ss_pred             ccchhhcCCCCCCCceecccCCCCcccCCCCCcCCcceEeecCChhH
Q 003899          714 ECLSSISENLTSLEFLYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLI  760 (788)
Q Consensus       714 ~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l  760 (788)
                      ..+|..+..+++|+.|++++|+....+|..+...++....+.++|.+
T Consensus       561 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~l  607 (968)
T PLN00113        561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDL  607 (968)
T ss_pred             ccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccc
Confidence            67888888888899999999877777887666555555555665533

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		788
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-20
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-10
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	4e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	9e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	9e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 95.3 bits (236), Expect = 3e-20
 Identities = 90/588 (15%), Positives = 166/588 (28%), Gaps = 149/588 (25%)

Query: 89  HLRTFLPVNLSNYRINYLAWSVLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHL---- 144
             +  L V    +  N+    V  M  +     + S     +II   + +     L    
Sbjct: 17  QYKDILSVFEDAFVDNFDCKDVQDMPKS-----ILSKEEIDHIIMSKDAVSGTLRLFWTL 71

Query: 145 ---------RFLN-LSRTSIQILPESINSLYN---LNTILLEDCYQLKKLCND------- 184
                    +F+  + R + + L   I +      + T +     Q  +L ND       
Sbjct: 72  LSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYI--EQRDRLYNDNQVFAKY 129

Query: 185 -------MGNLKK-LRHLKSSNVDSLEEMPKGFGKLTCL--------------------L 216
                     L++ L  L+ +    ++ +  G GK T +                    L
Sbjct: 130 NVSRLQPYLKLRQALLELRPAKNVLIDGV-LGSGK-TWVALDVCLSYKVQCKMDFKIFWL 187

Query: 217 TLGTFVVGKDGGSGLRELKSLTHL---QGTLQISKLENVKDVGDACEAQLN----SKENL 269
            L          + L  L+ L +      T +     N+K    + +A+L     SK   
Sbjct: 188 NLKNC---NSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYE 244

Query: 270 QALL-LK--WSTRDVQNLD-QCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSF 325
             LL L    + +     +  C  +  + +  K   D     ++    T   +     + 
Sbjct: 245 NCLLVLLNVQNAKAWNAFNLSC--KILLTTRFKQVTDF----LSAATTTHISLDHHSMTL 298

Query: 326 SKLARLELCR----CTSTSLPS--VGQLPFLMEL-------DISGMDGVKSVGSEFYRRS 372
           +      L      C    LP   +   P  + +        ++  D  K V  +     
Sbjct: 299 TPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTI 358

Query: 373 CSVPFPSLETLSFSDMRE----------------------WEEWIPCGAGQEVDEVFPKL 410
                 SL  L  ++ R+                      W + I      +V  V  KL
Sbjct: 359 IES---SLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIK----SDVMVVVNKL 411

Query: 411 RKLSLFNCHKLQGKLPKRLLLLETLVIKSCQQ-LLVTIQCLPALSELQIDGCERVVFSSP 469
            K SL          PK      T+ I S    L V ++   AL    +D          
Sbjct: 412 HKYSLVEKQ------PKE----STISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDS 461

Query: 470 IDLSSLKS-----VHLAYVANEVVLAGLFEQGLPKL-ENLVIVE--VREQAYLWQ---SE 518
            DL           H+ +    +            +  +   +E  +R  +  W    S 
Sbjct: 462 DDLIPPYLDQYFYSHIGHHLKNIEHPERMTL-FRMVFLDFRFLEQKIRHDSTAWNASGSI 520

Query: 519 TRLLQDIRSLNRLHISR-CPRLLSLVTDEEHDQQQPESP-YRLRFLEL 564
              LQ ++   + +I    P+   LV        + E      ++ +L
Sbjct: 521 LNTLQQLK-FYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTDL 567

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		788
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.98
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.98
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.96
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.94
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.93
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.93
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.93
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.86
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.85
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.85
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.84
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.84
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.82
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.81
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.78
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.78
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.78
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.78
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.77
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.77
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.77
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.76
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.75
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.73
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.73
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.71
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.7
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.69
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.69
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.69
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.69
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.68
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.66
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.66
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.65
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.65
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.65
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.64
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.63
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.63
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.61
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.6
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.59
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.59
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.58
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.58
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.57
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.55
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.54
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.49
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.48
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.48
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.48
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.46
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.46
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.46
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.46
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.45
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.44
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.41
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.41
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.41
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.38
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.38
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.37
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.37
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.36
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.36
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.36
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.35
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.35
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.33
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.33
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.31
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.3
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.3
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.3
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.28
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.27
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.27
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.23
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.2
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.19
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.16
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.15
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.13
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.12
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.11
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.1
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.1
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.09
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.04
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.03
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.0
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.98
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.92
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.91
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.83
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.78
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.72
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.67
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.64
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.36
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.26
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.09
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.06
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.99
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.94
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.91
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.91
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.88
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.88
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.84
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.82
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.69
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.59
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	97.09
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.78
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.85
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.61
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	92.07
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.87
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	85.75
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	82.97

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=6.8e-50  Score=465.75  Aligned_cols=634  Identities=18%  Similarity=0.086  Sum_probs=454.8

Q ss_pred             CceeEEEeccCCccccchhhhh---HHHHhCCCCCeeEEEccCCcCcccccccccCCCCCceeeccCCccc-ccch--hh
Q 003899           88 EHLRTFLPVNLSNYRINYLAWS---VLQMLMNLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQ-ILPE--SI  161 (788)
Q Consensus        88 ~~Lr~L~~~~~~~~~~~~~~~~---~~~~~~~l~~Lr~L~L~~~~~l~~lp~~~~~l~~L~~L~L~~~~i~-~lp~--~i  161 (788)
                      .+++.|.+.+..      +.+.   +++.+.++++|+.++++.+ .+..+|..|+++++|++|+|++|.+. .+|.  .+
T Consensus        50 ~~v~~L~L~~~~------l~g~~~~l~~~l~~L~~L~~l~~~~~-~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l  122 (768)
T 3rgz_A           50 DKVTSIDLSSKP------LNVGFSAVSSSLLSLTGLESLFLSNS-HINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSL  122 (768)
T ss_dssp             TEEEEEECTTSC------CCEEHHHHHHHTTTCTTCCEEECTTS-CEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGG
T ss_pred             CcEEEEECCCCC------cCCccCccChhHhccCcccccCCcCC-CcCCCchhhccCCCCCEEECCCCcCCCcCCChHHH
Confidence            355666555432      2233   6678888889999998888 67667788888999999999988887 4676  88


Q ss_pred             hccccCcEEEccCccchhhchhhh-hcccCCceEecCCCcCcccCCcc---CcCCCCcceeCceEeCCCCCCCccccccc
Q 003899          162 NSLYNLNTILLEDCYQLKKLCNDM-GNLKKLRHLKSSNVDSLEEMPKG---FGKLTCLLTLGTFVVGKDGGSGLRELKSL  237 (788)
Q Consensus       162 ~~L~~L~~L~L~~~~~l~~lp~~i-~~L~~L~~L~l~~~~~l~~~p~~---i~~l~~L~~L~~~~~~~~~~~~~~~l~~L  237 (788)
                      +++++|++|++++|.....+|..+ .++++|++|++++|......|..   ++++++|++|++..+...+....   ..+
T Consensus       123 ~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~---~~l  199 (768)
T 3rgz_A          123 GSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV---SRC  199 (768)
T ss_dssp             GGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC---TTC
T ss_pred             hCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc---ccC
Confidence            889999999998885445566554 78888999999988843444444   78888888888866654433222   344


Q ss_pred             ccCCceeEEeccCCCCCchhhhhcccCCCcCCceEEEEeecCcccCccchhhhhhhcccCccccccceEEEEeeCCCCC-
Q 003899          238 THLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKF-  316 (788)
Q Consensus       238 ~~L~~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~-  316 (788)
                      ..|+ .+.+.......    ... .+..+++|+.|+++++..          ....+..+..+++|+.|++++|..... 
T Consensus       200 ~~L~-~L~Ls~n~l~~----~~~-~l~~l~~L~~L~Ls~n~l----------~~~~~~~l~~l~~L~~L~Ls~n~l~~~~  263 (768)
T 3rgz_A          200 VNLE-FLDVSSNNFST----GIP-FLGDCSALQHLDISGNKL----------SGDFSRAISTCTELKLLNISSNQFVGPI  263 (768)
T ss_dssp             TTCC-EEECCSSCCCS----CCC-BCTTCCSCCEEECCSSCC----------CSCHHHHTTTCSSCCEEECCSSCCEESC
T ss_pred             CcCC-EEECcCCcCCC----CCc-ccccCCCCCEEECcCCcC----------CCcccHHHhcCCCCCEEECCCCcccCcc
Confidence            4444 44443322211    111 267788999999988776          344566788889999999998876533 


Q ss_pred             CcccCCCCCCCeeEEEECCCCC-CCCCC-CCC-CCCccEEEecCCCCceEeCcccccCCCCCCCCCcceEeccccccccc
Q 003899          317 PIWLGDSSFSKLARLELCRCTS-TSLPS-VGQ-LPFLMELDISGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEE  393 (788)
Q Consensus       317 p~~~~~~~~~~L~~L~L~~~~~-~~l~~-l~~-l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~  393 (788)
                      |.+    .+++|+.|++++|.+ ..+|. +.. +++|++|++++|.....++..+..      +++|++|+++++.-...
T Consensus       264 ~~~----~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~------l~~L~~L~L~~n~l~~~  333 (768)
T 3rgz_A          264 PPL----PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS------CSLLESLALSSNNFSGE  333 (768)
T ss_dssp             CCC----CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGG------CTTCCEEECCSSEEEEE
T ss_pred             Ccc----ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhc------CCCccEEECCCCcccCc
Confidence            332    588999999999988 57775 555 499999999998654444444432      89999999998644334


Q ss_pred             ccccCCCCcccccCCcccEEeeecCcccccCCCCCC---C-CccEEEEeccCCc---ccccCC--CCCccEEEeccCCcc
Q 003899          394 WIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLPKRL---L-LLETLVIKSCQQL---LVTIQC--LPALSELQIDGCERV  464 (788)
Q Consensus       394 ~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~lp~~l---~-~L~~L~l~~c~~l---~~~~~~--~~~L~~L~l~~~~~~  464 (788)
                      ++.     .....+++|++|++++| .+.+.+|..+   + +|+.|++++|...   ...+..  +++|++|++++|...
T Consensus       334 ip~-----~~l~~l~~L~~L~Ls~n-~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~  407 (768)
T 3rgz_A          334 LPM-----DTLLKMRGLKVLDLSFN-EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT  407 (768)
T ss_dssp             CCH-----HHHTTCTTCCEEECCSS-EEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEE
T ss_pred             CCH-----HHHhcCCCCCEEeCcCC-ccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccc
Confidence            443     02466899999999998 6666788543   3 8999999987543   222333  678999999999843


Q ss_pred             --eecCCcCCCCccEEeccccccceeeccccccCCCCccEEEEecCcccchhhhcccccccCCCCCCeEEcccCCCcccc
Q 003899          465 --VFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQAYLWQSETRLLQDIRSLNRLHISRCPRLLSL  542 (788)
Q Consensus       465 --~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~  542 (788)
                        ....+..+++|+.|++++|.....+|.. +..+++|+.|++++|.....+    +..+..+++|++|++++|.....+
T Consensus       408 ~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~-l~~l~~L~~L~L~~n~l~~~~----p~~~~~l~~L~~L~L~~N~l~~~~  482 (768)
T 3rgz_A          408 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS-LGSLSKLRDLKLWLNMLEGEI----PQELMYVKTLETLILDFNDLTGEI  482 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGG-GGGCTTCCEEECCSSCCCSCC----CGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             cccCHHHhcCCCCCEEECcCCcccCcccHH-HhcCCCCCEEECCCCcccCcC----CHHHcCCCCceEEEecCCcccCcC
Confidence              3456778999999999998655455554 578899999999999888776    888899999999999998654444


Q ss_pred             ccCccccccCCCCcccccceEE-EEEecCccCcccccccccCCCCcceEEEecCCCCcccCCCCCCCCcccEEEeccccc
Q 003899          543 VTDEEHDQQQPESPYRLRFLEL-KIFIYDLENLQSLPAGLHNLRHLQKIWISKCPNLESFPEEGLPSAKLTELMIWRCEN  621 (788)
Q Consensus       543 ~~~~~~~~~~~~~~~~l~~L~L-~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~l~~c~~  621 (788)
                      |..   +..+++         | .+++.+|.....+|..+..+++|++|++++|.....+|..+..+++|+.|++++|+.
T Consensus       483 p~~---l~~l~~---------L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l  550 (768)
T 3rgz_A          483 PSG---LSNCTN---------LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLF  550 (768)
T ss_dssp             CGG---GGGCTT---------CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEE
T ss_pred             CHH---HhcCCC---------CCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCcc
Confidence            432   224455         7 999999887778899999999999999999876668888888899999999999987


Q ss_pred             ccccccccCc---cceEeccCCC--------CC--------------------------------------CCCCC-CCC
Q 003899          622 LKALPNSMSS---LLRLGIIGCP--------SL--------------------------------------ESFPE-DGF  651 (788)
Q Consensus       622 l~~l~~~~~~---L~~L~l~~c~--------~l--------------------------------------~~~~~-~~~  651 (788)
                      ...+|..+..   +..+.+....        ..                                      ..+|. ...
T Consensus       551 ~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~  630 (768)
T 3rgz_A          551 NGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN  630 (768)
T ss_dssp             ESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSS
T ss_pred             CCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhc
Confidence            7777765432   1111111100        00                                      00010 112


Q ss_pred             CCCccEEEEeccCCCCcccccccCCCCCccEEEEcCCCCCcccCCC---CCCCCCeEecCCCCCcccchhhcCCCCCCCc
Q 003899          652 PTNLQSLEVRDLKITKPLLEWGLNRFTSLRNLSIGGGYPDLLSSPP---FPASLTELWISDMPDLECLSSISENLTSLEF  728 (788)
Q Consensus       652 ~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~---~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~  728 (788)
                      .++|+.|++++|...+.++. .++++++|+.|++++ +.-...+|.   .+++|+.|+|++|.--..+|..+..+++|++
T Consensus       631 l~~L~~LdLs~N~l~g~ip~-~l~~l~~L~~L~Ls~-N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~  708 (768)
T 3rgz_A          631 NGSMMFLDMSYNMLSGYIPK-EIGSMPYLFILNLGH-NDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTE  708 (768)
T ss_dssp             SBCCCEEECCSSCCBSCCCG-GGGGCTTCCEEECCS-SCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSE
T ss_pred             cccccEEECcCCcccccCCH-HHhccccCCEEeCcC-CccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCE
Confidence            36899999999887766664 689999999999999 555557887   7899999999996555589999999999999


Q ss_pred             eecccCCCCcccCCCCCcCCcceEeecCChhHH----HhhcCCCCcccCcccccceEE
Q 003899          729 LYLIDCPKLKYFPEQGLPKSLSRLSIHNCPLIE----KRCRKDEGKYWPMISHIPHFN  782 (788)
Q Consensus       729 L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~----~~~~~~~~~~~~~~~~~~~~~  782 (788)
                      |++++|+-...+|+.+.+.++....+.|||.+-    ..|....+.+|++|+|+++.+
T Consensus       709 L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          709 IDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             EECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             EECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            999999777889988887888888888887542    279999999999999998864

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		788
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.001
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.002

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 40.4 bits (93), Expect = 7e-04
 Identities = 49/371 (13%), Positives = 105/371 (28%), Gaps = 30/371 (8%)

Query: 116 NLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDC 175
           +L ++          I  +   +E L +L  +N S   +  +   + +L  L  IL+ + 
Sbjct: 42  DLDQVTTLQADR-LGIKSIDG-VEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNN 98

Query: 176 YQLKKLCNDMGNLKKLRHLKSSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELK 235
                             L ++ +  ++ +          L+  T              +
Sbjct: 99  QIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQ 158

Query: 236 SLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLKWSTRDVQNLDQCEFETHVLS 295
                Q T                 +   S  ++ A L    +    N          +S
Sbjct: 159 LSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQ--------IS 210

Query: 296 VLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDI 355
            + P   +  L      G +       +S + L  L+L     ++L  +  L  L EL +
Sbjct: 211 DITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKL 270

Query: 356 SGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSL 415
                         + S   P   L     + +   E                 L  L+L
Sbjct: 271 GAN-----------QISNISPLAGL-----TALTNLELNENQLEDISPISNLKNLTYLTL 314

Query: 416 FNCHKLQGKLP-KRLLLLETLVIKSCQ-QLLVTIQCLPALSELQIDGCERVVFSSPIDLS 473
           +    +    P   L  L+ L   + +   + ++  L  ++ L     +    +   +L+
Sbjct: 315 YFN-NISDISPVSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLT 373

Query: 474 SLKSVHLAYVA 484
            +  + L   A
Sbjct: 374 RITQLGLNDQA 384

PyMOL of d2omza2

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		788
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.87
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.84
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.74
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.73
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.71
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.7
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.67
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.66
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.59
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.56
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.52
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.52
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.52
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.5
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.49
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.43
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.41
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.4
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.34
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.33
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.32
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.31
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.31
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.3
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.2
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.18
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.12
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.07
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.01
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.99
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.95
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.89
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.75
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.36
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.22
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.95
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.84
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.76
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.73
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.0
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.8

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=6.8e-21  Score=201.19  Aligned_cols=339  Identities=18%  Similarity=0.185  Sum_probs=183.8

Q ss_pred             CCCCeeEEEccCCcCcccccccccCCCCCceeeccCCcccccchhhhccccCcEEEccCccchhhchhhhhcccCCceEe
Q 003899          116 NLPRLRVFSLHGYSNIIELPNEIENLKHLRFLNLSRTSIQILPESINSLYNLNTILLEDCYQLKKLCNDMGNLKKLRHLK  195 (788)
Q Consensus       116 ~l~~Lr~L~L~~~~~l~~lp~~~~~l~~L~~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~L~~L~~L~  195 (788)
                      .+.+|++|+++++ .++++ +.++.+++|++|+|++|+|+.+|. ++++++|++|++++| .+..++. ++++++|+.|+
T Consensus        42 ~l~~l~~L~l~~~-~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~~-l~~l~~L~~L~  116 (384)
T d2omza2          42 DLDQVTTLQADRL-GIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADITP-LANLTNLTGLT  116 (384)
T ss_dssp             HHTTCCEEECCSS-CCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCGG-GTTCTTCCEEE
T ss_pred             HhCCCCEEECCCC-CCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-ccccccc-ccccccccccc
Confidence            3467888999888 88887 568889999999999999998875 888999999999998 6777764 88899999999


Q ss_pred             cCCCcCcccCCccCcCCCCcceeCceEeCCCCCCCcccccccccCCceeEEeccCCCCCchhhhhcccCCCcCCceEEEE
Q 003899          196 SSNVDSLEEMPKGFGKLTCLLTLGTFVVGKDGGSGLRELKSLTHLQGTLQISKLENVKDVGDACEAQLNSKENLQALLLK  275 (788)
Q Consensus       196 l~~~~~l~~~p~~i~~l~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~  275 (788)
                      ++++. ...++.. .....+..+....+......   ........+ . .........      ...+............
T Consensus       117 ~~~~~-~~~~~~~-~~~~~~~~~~~~~~~l~~~~---~~~~~~~~~-~-~~~~~~~~~------~~~~~~~~~~~~~~~~  183 (384)
T d2omza2         117 LFNNQ-ITDIDPL-KNLTNLNRLELSSNTISDIS---ALSGLTSLQ-Q-LSFGNQVTD------LKPLANLTTLERLDIS  183 (384)
T ss_dssp             CCSSC-CCCCGGG-TTCTTCSEEEEEEEEECCCG---GGTTCTTCS-E-EEEEESCCC------CGGGTTCTTCCEEECC
T ss_pred             ccccc-ccccccc-cccccccccccccccccccc---ccccccccc-c-cccccccch------hhhhcccccccccccc
Confidence            98887 4444432 22333333333222111100   000000000 0 000000000      0001111111111110


Q ss_pred             eecCcccCccchhhhhhhcccCccccccceEEEEeeCCCCCCcccCCCCCCCeeEEEECCCCCCCCCCCCCCCCccEEEe
Q 003899          276 WSTRDVQNLDQCEFETHVLSVLKPHQDVQELTITGYGGTKFPIWLGDSSFSKLARLELCRCTSTSLPSVGQLPFLMELDI  355 (788)
Q Consensus       276 ~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~p~~~~~~~~~~L~~L~L~~~~~~~l~~l~~l~~L~~L~l  355 (788)
                      .+            ..........+++++.++++++....++.+.   ..++|+.|++++|.+..++.+..+++|+.|++
T Consensus       184 ~~------------~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~~---~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l  248 (384)
T d2omza2         184 SN------------KVSDISVLAKLTNLESLIATNNQISDITPLG---ILTNLDELSLNGNQLKDIGTLASLTNLTDLDL  248 (384)
T ss_dssp             SS------------CCCCCGGGGGCTTCSEEECCSSCCCCCGGGG---GCTTCCEEECCSSCCCCCGGGGGCTTCSEEEC
T ss_pred             cc------------ccccccccccccccceeeccCCccCCCCccc---ccCCCCEEECCCCCCCCcchhhcccccchhcc
Confidence            00            0011122333445555555555444443322   34455555555555544444555555555555


Q ss_pred             cCCCCceEeCcccccCCCCCCCCCcceEecccccccccccccCCCCcccccCCcccEEeeecCcccccCCC--CCCCCcc
Q 003899          356 SGMDGVKSVGSEFYRRSCSVPFPSLETLSFSDMREWEEWIPCGAGQEVDEVFPKLRKLSLFNCHKLQGKLP--KRLLLLE  433 (788)
Q Consensus       356 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~lp--~~l~~L~  433 (788)
                      ++|. +..++                                     ....+++|++|+++++ .+. .++  ..++.++
T Consensus       249 ~~n~-l~~~~-------------------------------------~~~~~~~L~~L~l~~~-~l~-~~~~~~~~~~l~  288 (384)
T d2omza2         249 ANNQ-ISNLA-------------------------------------PLSGLTKLTELKLGAN-QIS-NISPLAGLTALT  288 (384)
T ss_dssp             CSSC-CCCCG-------------------------------------GGTTCTTCSEEECCSS-CCC-CCGGGTTCTTCS
T ss_pred             ccCc-cCCCC-------------------------------------cccccccCCEeeccCc-ccC-CCCccccccccc
Confidence            5543 21111                                     1223455555555544 333 122  2334444


Q ss_pred             EEEEeccCCc-ccccCCCCCccEEEeccCCcceecCCcCCCCccEEeccccccceeeccccccCCCCccEEEEecCcccc
Q 003899          434 TLVIKSCQQL-LVTIQCLPALSELQIDGCERVVFSSPIDLSSLKSVHLAYVANEVVLAGLFEQGLPKLENLVIVEVREQA  512 (788)
Q Consensus       434 ~L~l~~c~~l-~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~  512 (788)
                      .+.+..+... ...+..++++++|++++|.......+..+++|++|++++| .++.++.  +..+++|++|++++|+...
T Consensus       289 ~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~n-~l~~l~~--l~~l~~L~~L~l~~N~l~~  365 (384)
T d2omza2         289 NLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANN-KVSDVSS--LANLTNINWLSAGHNQISD  365 (384)
T ss_dssp             EEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCCGGGGGCTTCCEEECCSS-CCCCCGG--GGGCTTCCEEECCSSCCCB
T ss_pred             cccccccccccccccchhcccCeEECCCCCCCCCcccccCCCCCEEECCCC-CCCCChh--HcCCCCCCEEECCCCcCCC
Confidence            5544443311 1235557777888888777555555667888888888886 4555553  4678888888888887654


Q ss_pred             hhhhcccccccCCCCCCeEEcccC
Q 003899          513 YLWQSETRLLQDIRSLNRLHISRC  536 (788)
Q Consensus       513 ~~~~~~~~~~~~l~~L~~L~l~~c  536 (788)
                      ..      .+.++++|++|+++++
T Consensus       366 l~------~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         366 LT------PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             CG------GGTTCTTCSEEECCCE
T ss_pred             Ch------hhccCCCCCEeeCCCC
Confidence            32      2677888888888764

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure