Citrus Sinensis ID: 003973


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780--
MAAAAKAGEATLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLNTGSLFYATLNAIAYFYMVCSWGGYTFIINLIPMHVLLCIVTGRYSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIILHVVALVYYIKGILSPKMFKVAVTLVVSVGLVVCCAVIAILVALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIVTSVYFSGVMVRLMLVFAPAACIMSGIALSQAFDVFTRSIKFQLLRILGFSEADAGDGSSANVVPENDAVKVDKSEETIKERPSRKNKKKEKEQMEKAQAEKTSAKSKTEKRLLVLPMELSVIGLLLLVFMGAFYVVHCVWAAAEAYSAPSIVLTSYTHEGLHVFDDFREAYAWLRHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDGKGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPSKNRIRGKMKKSKSRTSTPSSKRSGSRKKNPWQ
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccCCcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccccccccEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEEccccccccccHHHHHHHHHHHccccccccEEEcccccHHHHHccccEEEcccccccccHHHHHHHHccccHHHHHHHHHcccccEEEEEEccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccc
**********TLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLNTGSLFYATLNAIAYFYMVCSWGGYTFIINLIPMHVLLCIVTGRYSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIILHVVALVYYIKGILSPKMFKVAVTLVVSVGLVVCCAVIAILVALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIVTSVYFSGVMVRLMLVFAPAACIMSGIALSQAFDVFTRSIKFQLLRILGFSEADAGDGSSA***********************************************TEKRLLVLPMELSVIGLLLLVFMGAFYVVHCVWAAAEAYSAPSIVLTSYTHEGLHVFDDFREAYAWLRHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDGKGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPSKN******************************
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAKAGEATLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLNTGSLFYATLNAIAYFYMVCSWGGYTFIINLIPMHVLLCIVTGRYSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIILHVVALVYYIKGILSPKMFKVAVTLVVSVGLVVCCAVIAILVALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIVTSVYFSGVMVRLMLVFAPAACIMSGIALSQAFDVFTRSIKFQLLRILGFSEADAGDGSSANVVPENDAVKVDKSEETIKERPSRKNxxxxxxxxxxxxxxxxxxxxxxxKRLLVLPMELSVIGLLLLVFMGAFYVVHCVWAAAEAYSAPSIVLTSYTHEGLHVFDDFREAYAWLRHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDGKGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPSKNRIRGKMKKSKSRTSTPSSKRSGSRKKNPWQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Catalytic subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity.confidentQ6F2Z1
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Catalytic subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity (By similarity). Controls adaptive responses to salt/osmotic stress. Acts as a key glycosylation determinant for EFR function during plant innate immunity.confidentQ93ZY3
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity.probableP46977

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.119Dolichyl-diphosphooligosaccharide--protein glycotransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LGZ, chain A
Confidence level:very confident
Coverage over the Query: 531-774
View the alignment between query and template
View the model in PyMOL
Template: 3RCE, chain A
Confidence level:very confident
Coverage over the Query: 20-261,274-305,338-437,484-491,513-546,557-632
View the alignment between query and template
View the model in PyMOL