Citrus Sinensis ID: 003974


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780--
MGRPVKRTSTQVAAEESNHSKARRRKLNLAEQQHQQQEEQREDEEVKEEPVELVTRVKKKTQKNKPDSDLFFVSPPVSADEALKRYPDRYKALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPCDLYYDMKYTLPHLTFLNINNESNRRDSDASSTISSETGSNSPIGQPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANVPNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEIIVAYANNQPCQLEKGVLLSDAISDLPLVTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNNDDYERVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPVKER
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccEECcccccHHHHHHHccccccccHHHHHHHcccEEEEEEEEccEEEEEccEEEEEcccccccEEEEEEEEEECcccccEEEEEEEEEcccccccccccccccccEEEEEEECccccccEEEEEEEEEEccccccHHHccccccccEEECcccccccccCCcccccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEEEEEccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHEEEHHcccccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEECccccccHcccccccccccccccccHHHHHHHHHHHHHHcccEEEEcccHHHHccccHHHHHHHHHHHHccccEEEEEEEECccccccccccEEEEEECcccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccEEEEcccccc
***********************************************************************FVSPPVSA*********RYKALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPCDLYYDMKYTLPHLTFLN********************************LLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDT***********************************FEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEIIVAYANNQPCQLEKGVLLSDAISDLPLVTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNNDDYERVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRPVKRTSTQVAAEESNHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVELVTRVKKKTQKNKPDSDLFFVSPPVSADEALKRYPDRYKALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPCDLYYDMKYTLPHLTFLNINNESNRRDSDASSTISSETGSNSPIGQPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFxxxxxxxxxxxxxxxxxxxxxPNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEIIVAYANNQPCQLEKGVLLSDAISDLPLVTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNNDDYERVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPVKER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA (cytosine-5)-methyltransferase CMT3 Involved in the CpXpG methylation and in gene silencing. Methylates preferentially transposon-related sequences. Functionally redundant to DRM1/DRM2 to maintain non-CpG methylation. Involved in RNA-directed DNA methylation.probableQ94F88

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.37DNA (cytosine-5-)-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SWR, chain A
Confidence level:very confident
Coverage over the Query: 20-80,101-328,388-393,436-634,648-781
View the alignment between query and template
View the model in PyMOL
Template: 3G7U, chain A
Confidence level:very confident
Coverage over the Query: 261-323,374-385,431-459,472-565,589-677,721-780
View the alignment between query and template
View the model in PyMOL
Template: 4FT4, chain B
Confidence level:very confident
Coverage over the Query: 68-232,259-337,376-781
View the alignment between query and template
View the model in PyMOL