Citrus Sinensis ID: 003974
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 782 | ||||||
| 225441510 | 829 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.937 | 0.884 | 0.655 | 0.0 | |
| 255579031 | 845 | protein with unknown function [Ricinus c | 0.962 | 0.891 | 0.639 | 0.0 | |
| 297739809 | 827 | unnamed protein product [Vitis vinifera] | 0.937 | 0.886 | 0.656 | 0.0 | |
| 356495335 | 834 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.933 | 0.875 | 0.615 | 0.0 | |
| 356540854 | 830 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.936 | 0.881 | 0.607 | 0.0 | |
| 358345790 | 827 | DNA (cytosine-5)-methyltransferase [Medi | 0.945 | 0.893 | 0.608 | 0.0 | |
| 357484051 | 835 | DNA (cytosine-5)-methyltransferase [Medi | 0.920 | 0.862 | 0.617 | 0.0 | |
| 356497585 | 868 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.932 | 0.839 | 0.592 | 0.0 | |
| 159461700 | 925 | CMT-type DNA-methyltransferase [Elaeis g | 0.984 | 0.832 | 0.574 | 0.0 | |
| 330370547 | 824 | chromomethylase 3 [Gossypium hirsutum] | 0.920 | 0.873 | 0.583 | 0.0 |
| >gi|225441510|ref|XP_002275932.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1035 bits (2676), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 503/767 (65%), Positives = 607/767 (79%), Gaps = 34/767 (4%)
Query: 48 EEPVELVTRVKKKTQKNKPDSDLFFVSPPVSADEALKRYPDRYKALN------------- 94
EE L V KKT+K++ ++ V P+S +EA +++P RY + N
Sbjct: 9 EEAAPLQPCVVKKTKKSRAAAEASVVGAPISVNEARQKWPQRYISTNKFRKGSDSRTKDE 68
Query: 95 --EEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKA 152
E E++LQAR H+T+A VDGC+Y L D AYVKAE+G D+IA+IVELFE++D EPYF A
Sbjct: 69 SIEAEDILQARRHFTEAVVDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREPYFTA 128
Query: 153 RWFYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIP 212
+WF+RAEDTVIKD A LVD+KRVF SD+ DDNPL+CIVSK +I +VA N+DL K+K IP
Sbjct: 129 QWFFRAEDTVIKDHAHLVDQKRVFYSDMRDDNPLDCIVSKVEIVQVAPNVDLAEKEKTIP 188
Query: 213 PCDLYYDMKYTLPHLTFLNINNESNRRDSDASSTISSETG-------SNSPIGQPE---- 261
PCDLYYDM Y+L HLTF N+ E++R +SD SSTISSE G NS IG+
Sbjct: 189 PCDLYYDMSYSLKHLTFANLLTENSRTESDESSTISSEIGLNSTTDGINSAIGESSQVHK 248
Query: 262 -----MSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRN 316
M+LLDLYSGCGAMSTGLC+GASLSG+KLVTRWA+DINPHAC+SLK NHPET+VRN
Sbjct: 249 FQGSGMTLLDLYSGCGAMSTGLCLGASLSGLKLVTRWAVDINPHACESLKLNHPETEVRN 308
Query: 317 EAADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANVPNEE 376
EAA+DFLSLLKEWA LC+ FS+ + + PE +N +S ++EE+ + DD + VP E
Sbjct: 309 EAAEDFLSLLKEWATLCEDFSLLGSRR-PE-VVNPISNRSGSDDEEDADGDDGSPVPRGE 366
Query: 377 FEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYR 436
FEV++L+A+CYGDPN+ KPG+YFKVRWKGYGPS+DTWEPI+GLSKCK+ +KEFV KGYR
Sbjct: 367 FEVKKLVAICYGDPNEINKPGLYFKVRWKGYGPSDDTWEPIEGLSKCKKSVKEFVKKGYR 426
Query: 437 SNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLM 496
S+ILPLPGDVDFICGGPPCQGVSGFNRFRN +A L+D KN QL+VFMD++ YLKPKYVLM
Sbjct: 427 SSILPLPGDVDFICGGPPCQGVSGFNRFRNTEAPLDDPKNHQLVVFMDIVNYLKPKYVLM 486
Query: 497 ENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLP 556
ENVVDILKF+GGFL RYA+GRLVSM+YQ RLG+MAAGSYG+PQ+R+RVFLWGA P +KLP
Sbjct: 487 ENVVDILKFAGGFLGRYAMGRLVSMNYQARLGMMAAGSYGVPQYRMRVFLWGAHPMEKLP 546
Query: 557 QYPLPTHEIVARGVIPNEFQEIIVAYANNQPCQLEKGVLLSDAISDLPLVTNNESEDERK 616
YPLPTH+++ RGV+PNEF+EI V Y ++ C+LEK + L DAISDLP VTN +DE
Sbjct: 547 PYPLPTHDVIGRGVVPNEFEEITVGYDKSELCKLEKALFLGDAISDLPPVTNYNGQDEMP 606
Query: 617 YGTVARTEFQKYIRLRRHDVVNLSSAQM-ASRPSLLYDHRPFQVNNDDYERVCCIPKRKG 675
Y A TEFQ+YIRLR+HD+V S A+ AS P +LYDHRP Q+N DD ERVC IPK+KG
Sbjct: 607 YNKAAHTEFQRYIRLRKHDMVYCSDAEKDASEPPMLYDHRPLQLNEDDNERVCRIPKKKG 666
Query: 676 ANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIV 735
ANFRDLPGV+VG DN+V WDPSMERV+L SGKPLVPDYAM F STKPF RLWWDEIV
Sbjct: 667 ANFRDLPGVMVGSDNRVEWDPSMERVLLPSGKPLVPDYAMSFVRGKSTKPFARLWWDEIV 726
Query: 736 NTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPVKER 782
TVVTRA+PHN+ ++HP+QDRVLTIRENAR QGFPDCY+L GPVKER
Sbjct: 727 ATVVTRAEPHNQAIIHPTQDRVLTIRENARFQGFPDCYKLCGPVKER 773
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579031|ref|XP_002530367.1| protein with unknown function [Ricinus communis] gi|223530114|gb|EEF32028.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297739809|emb|CBI29991.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356495335|ref|XP_003516534.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540854|ref|XP_003538899.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358345790|ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] gi|355502893|gb|AES84096.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357484051|ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] gi|355513647|gb|AES95270.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356497585|ref|XP_003517640.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|159461700|gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|330370547|gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 782 | ||||||
| TAIR|locus:2025787 | 791 | CMT1 "chromomethylase 1" [Arab | 0.915 | 0.905 | 0.513 | 9.7e-199 | |
| TAIR|locus:2205015 | 839 | CMT3 "chromomethylase 3" [Arab | 0.877 | 0.817 | 0.525 | 1.1e-195 | |
| TAIR|locus:2117104 | 1295 | CMT2 "chromomethylase 2" [Arab | 0.907 | 0.548 | 0.496 | 1.4e-192 | |
| UNIPROTKB|Q7Y1I7 | 1527 | MET1A "DNA (cytosine-5)-methyl | 0.285 | 0.146 | 0.360 | 2.4e-50 | |
| TAIR|locus:2122313 | 1512 | AT4G08990 [Arabidopsis thalian | 0.291 | 0.150 | 0.364 | 2.4e-47 | |
| TAIR|locus:2155959 | 1534 | MET1 "methyltransferase 1" [Ar | 0.294 | 0.149 | 0.350 | 1.6e-45 | |
| TAIR|locus:2140892 | 1404 | MEE57 "maternal effect embryo | 0.223 | 0.124 | 0.376 | 5.4e-45 | |
| MGI|MGI:94912 | 1620 | Dnmt1 "DNA methyltransferase ( | 0.292 | 0.141 | 0.301 | 1.8e-44 | |
| ZFIN|ZDB-GENE-990714-15 | 1500 | dnmt1 "DNA (cytosine-5-)-methy | 0.309 | 0.161 | 0.313 | 1.7e-43 | |
| UNIPROTKB|F1S3I5 | 1611 | DNMT1 "Cytosine-specific methy | 0.297 | 0.144 | 0.304 | 6.6e-43 |
| TAIR|locus:2025787 CMT1 "chromomethylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1924 (682.3 bits), Expect = 9.7e-199, P = 9.7e-199
Identities = 382/744 (51%), Positives = 505/744 (67%)
Query: 59 KKTQKNKPDSDLFFVSPPVSADEALKRYPDRY------------KALN-----EEEEVL- 100
K+ ++ +P+SDL F P+S E+ R+P RY K N E+EE++
Sbjct: 6 KQKKRAEPESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDEEIIK 65
Query: 101 QARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAED 160
QA+CH+ +A VDG L NL DD YV G + +IA+++ELFE+ DG PY + RW+YR ED
Sbjct: 66 QAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPED 125
Query: 161 TVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVAT-NMDLEAKQKNIPPCDLYYD 219
T+I+ + LV KRVFLS+ E+DNPL CI SK IA+V + +Q+ IPPCD YYD
Sbjct: 126 TLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIPPCDYYYD 185
Query: 220 MKYTLPHLTFLNINNESNRRDXXXXXXXXXXXXXXXPIGQPEMSLLDLYSGCGAMSTGLC 279
MKY +P+L F + ++ S D + + E LLDLYSGCGAMSTG C
Sbjct: 186 MKYEVPYLNFTSADDGS---DASSSLSSDSALNCFENLHKDEKFLLDLYSGCGAMSTGFC 242
Query: 280 IGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIY 339
+GAS+SGVKL+T+W++DIN AC SLK NHPET+VRNEAA+DFL+LLKEW +LC+ FS+
Sbjct: 243 MGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDFLALLKEWKRLCEKFSLV 302
Query: 340 DTDKVPEQSLNFMSXXXXXXXXXXXXNDDDANVPNEEFEVERLIAVCYGDPNKTKKPGVY 399
+ + P +S++ + A + EFEVE+ + + +GDP T + +
Sbjct: 303 SSTE-PVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFLGIMFGDPQGTGEKTLQ 361
Query: 400 FKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVS 459
VRWKGY S DTWEP GL CKEKLKE+V G++S++LPLPG V +CGGPPCQG+S
Sbjct: 362 LMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVIDGFKSHLLPLPGTVYTVCGGPPCQGIS 421
Query: 460 GFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLV 519
G+NR+RN +A LED KN+QLLVF+D+I++LKP YVLMENVVD+L+FS GFLAR+AV V
Sbjct: 422 GYNRYRNNEAPLEDQKNQQLLVFLDIIDFLKPNYVLMENVVDLLRFSKGFLARHAVASFV 481
Query: 520 SMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEII 579
+M+YQTRLG+MAAGSYGLPQ R RVFLW A+P +KLP YPLPTHE+ + P EF+++
Sbjct: 482 AMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQPSEKLPPYPLPTHEVAKKFNTPKEFKDLQ 541
Query: 580 VAYANNQPCQLEKGVLLSDAISDLPLVTNNESEDERKYGTVA-RTEFQKYIRLRRHDVVN 638
V + +L+ + L+DAISDLP VTN + D Y A +TEF+ +I L+R +
Sbjct: 542 VGRIQMEFLKLDNALTLADAISDLPPVTNYVANDVMDYNDAAPKTEFENFISLKRSET-- 599
Query: 639 LSSAQMASRPSLLYDHRPFQVNNDDYERVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSM 698
L A L+DH+P + +DD ERV IPK+KGAN+RD+PGVLV +NK +P
Sbjct: 600 LLPAFGGDPTRRLFDHQPLVLGDDDLERVSYIPKQKGANYRDMPGVLVH-NNKAEINPRF 658
Query: 699 ERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVL 758
R LKSGK +VP YA+ F S KPFGRLW DEIVNTVVTRA+PHN+ ++HP Q+RVL
Sbjct: 659 -RAKLKSGKNVVPAYAISFIKGKSKKPFGRLWGDEIVNTVVTRAEPHNQCVIHPMQNRVL 717
Query: 759 TIRENARLQGFPDCYQLFGPVKER 782
++RENARLQGFPDCY+L G +KE+
Sbjct: 718 SVRENARLQGFPDCYKLCGTIKEK 741
|
|
| TAIR|locus:2205015 CMT3 "chromomethylase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117104 CMT2 "chromomethylase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y1I7 MET1A "DNA (cytosine-5)-methyltransferase 1A" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122313 AT4G08990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155959 MET1 "methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140892 MEE57 "maternal effect embryo arrest 57" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:94912 Dnmt1 "DNA methyltransferase (cytosine-5) 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990714-15 dnmt1 "DNA (cytosine-5-)-methyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3I5 DNMT1 "Cytosine-specific methyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025412001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (816 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| SAMDC | • | 0.899 | |||||||||
| GSVIVG00031656001 | • | 0.899 | |||||||||
| METK5 | • | 0.899 | |||||||||
| GSVIVG00026899001 | • | 0.899 | |||||||||
| METK4 | • | 0.899 | |||||||||
| METK1 | • | 0.899 | |||||||||
| pVvSAMDC | • | 0.899 | |||||||||
| GSVIVG00019871001 | • | 0.899 | |||||||||
| METK2 | • | 0.899 | |||||||||
| GSVIVG00017121001 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 782 | |||
| cd04716 | 122 | cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho | 9e-52 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 3e-18 | |
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 8e-18 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 3e-16 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 1e-15 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 1e-13 | |
| cd00024 | 55 | cd00024, CHROMO, Chromatin organization modifier ( | 4e-12 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 7e-12 | |
| TIGR00675 | 315 | TIGR00675, dcm, DNA-methyltransferase (dcm) | 2e-11 | |
| smart00298 | 55 | smart00298, CHROMO, Chromatin organization modifie | 2e-10 | |
| pfam00385 | 52 | pfam00385, Chromo, Chromo (CHRromatin Organisation | 5e-09 | |
| cd04717 | 121 | cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom | 1e-08 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 5e-08 | |
| cd04713 | 146 | cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol | 1e-07 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 4e-07 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 3e-06 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 2e-05 | |
| cd04760 | 124 | cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol | 2e-05 | |
| cd04714 | 121 | cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo | 6e-05 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 7e-05 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 6e-04 | |
| TIGR00675 | 315 | TIGR00675, dcm, DNA-methyltransferase (dcm) | 0.001 | |
| cd04721 | 130 | cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol | 0.002 |
| >gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
Score = 175 bits (446), Expect = 9e-52
Identities = 63/122 (51%), Positives = 85/122 (69%)
Query: 113 GCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLACLVDR 172
G YNLGDDAYV+ EG +I +I E FE DG+ YF A+WFYRAEDTVI+ A D+
Sbjct: 1 GITYNLGDDAYVQGGEGEEPFICKITEFFEGTDGKTYFTAQWFYRAEDTVIERQATNHDK 60
Query: 173 KRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPCDLYYDMKYTLPHLTFLNI 232
KRVF S++++DNPL+C++SK KI +V N+ + K+ N CD YYDM+Y +P+ TF +
Sbjct: 61 KRVFYSEIKNDNPLDCLISKVKILQVPPNVGTKRKKPNSEKCDYYYDMEYCVPYSTFQTL 120
Query: 233 NN 234
N
Sbjct: 121 RN 122
|
DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 122 |
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 782 | |||
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 100.0 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 100.0 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 100.0 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 100.0 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 100.0 | |
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 99.96 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 99.95 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.94 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 99.93 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 99.92 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.91 | |
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 99.9 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.89 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.89 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.89 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.89 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.88 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 99.88 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.88 | |
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.84 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.77 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 99.76 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.72 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.67 | |
| KOG1886 | 464 | consensus BAH domain proteins [Transcription] | 99.57 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 99.14 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 98.47 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 97.14 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 96.87 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.87 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 96.79 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 96.78 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 96.76 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 96.71 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 96.6 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 96.5 | |
| cd00024 | 55 | CHROMO Chromatin organization modifier (chromo) do | 96.22 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 96.21 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 96.17 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 96.13 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 96.13 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 96.1 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 96.0 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 95.97 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 95.79 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 95.71 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 95.61 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 95.61 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 95.35 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 95.08 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 94.9 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 94.89 | |
| PF00385 | 55 | Chromo: Chromo (CHRromatin Organisation MOdifier) | 94.81 | |
| smart00298 | 55 | CHROMO Chromatin organization modifier domain. | 94.64 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 94.41 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 94.34 | |
| KOG1911 | 270 | consensus Heterochromatin-associated protein HP1 a | 94.08 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 93.89 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 93.87 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 93.83 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 93.75 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 93.52 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 93.45 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 93.21 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 92.73 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 92.72 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 92.59 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 92.51 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 92.5 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 92.19 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 92.09 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 91.68 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 91.37 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 90.63 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 90.62 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 90.43 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 90.4 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 89.96 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 89.87 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 89.6 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 89.39 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 89.29 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 89.17 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 88.82 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 88.46 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 87.62 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 86.55 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 86.03 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 85.92 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 85.19 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 84.6 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 84.37 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 83.2 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 83.07 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 82.97 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 82.89 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 82.53 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 82.52 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 82.49 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 82.32 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 82.26 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 82.22 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 81.78 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 81.44 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 81.43 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 81.37 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 81.2 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 80.99 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 80.24 |
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-53 Score=462.14 Aligned_cols=173 Identities=27% Similarity=0.458 Sum_probs=149.5
Q ss_pred eeccccccchhHHHHHHhhhhcCCceeeEEEEecCHHHHHHHHHhCCCCcccccchHHHHHHHHHHHHHhhhhcccCCCC
Q 003974 264 LLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDTDK 343 (782)
Q Consensus 264 ~ldlf~G~Gg~s~Gl~~g~~~aG~~~~~~~ave~~~~a~~t~~~N~p~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~ 343 (782)
++|||||||||++|| +.||++++ ||+|+|+.|++||++|||+ .+..+||.++.
T Consensus 1 vidLF~G~GG~~~Gl----~~aG~~~~--~a~e~~~~a~~ty~~N~~~-~~~~~Di~~~~-------------------- 53 (315)
T TIGR00675 1 FIDLFAGIGGIRLGF----EQAGFKCV--FASEIDKYAQKTYEANFGN-KVPFGDITKIS-------------------- 53 (315)
T ss_pred CEEEecCccHHHHHH----HHcCCeEE--EEEeCCHHHHHHHHHhCCC-CCCccChhhhh--------------------
Confidence 689999999999999 78998854 9999999999999999998 66666765541
Q ss_pred CcccccccCchhhhhhhhhhhcccCCCCCCchhHHHHHHHHHhcCCCCCCCCCcceeEEeeccCCCCCCCcccccccchh
Q 003974 344 VPEQSLNFMSEEEEEEEEEEEENDDDANVPNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKC 423 (782)
Q Consensus 344 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~ 423 (782)
..+
T Consensus 54 ------------------------------~~~----------------------------------------------- 56 (315)
T TIGR00675 54 ------------------------------PSD----------------------------------------------- 56 (315)
T ss_pred ------------------------------hhh-----------------------------------------------
Confidence 000
Q ss_pred hhhhHHhHhccccccCCCCCCCccEEEecCCchhhcccCcCCCCCccccccccchHHHHHHHHHHhCCcEEEeccccccc
Q 003974 424 KEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDIL 503 (782)
Q Consensus 424 ~~~~~~~~~~~~~~~~~p~~~~vDvl~ggpPCQ~fS~ag~~~~~~~~~~d~r~~L~~~~~~ii~~~~P~~~v~ENV~gl~ 503 (782)
.+++|||+||||||+||.+|+++ +.+|+|+.|+++++++|+.++|++|+||||+||+
T Consensus 57 -------------------~~~~dvl~gg~PCq~fS~ag~~~----~~~d~r~~L~~~~~r~i~~~~P~~~v~ENV~~l~ 113 (315)
T TIGR00675 57 -------------------IPDFDILLGGFPCQPFSIAGKRK----GFEDTRGTLFFEIVRILKEKKPKFFLLENVKGLV 113 (315)
T ss_pred -------------------CCCcCEEEecCCCcccchhcccC----CCCCchhhHHHHHHHHHhhcCCCEEEeeccHHHH
Confidence 13689999999999999998744 3578999999999999999999999999999999
Q ss_pred cccccchHHHHHHHHhcCCcceEEEEEecccCCCCccccEEEEEEec-CCCC-CCCCCCCcc
Q 003974 504 KFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGAR-PFKK-LPQYPLPTH 563 (782)
Q Consensus 504 ~~~~~~~~~~i~~~l~~~GY~v~~~ilnA~~yGvPQ~R~R~flig~~-~~~~-~p~~P~pth 563 (782)
+..++..+..++..|+.+||.+.+.+|||++||+||+|+|+|+||++ .+.. ...||.|||
T Consensus 114 ~~~~~~~~~~i~~~l~~~GY~v~~~~l~a~dyGvPQ~R~R~f~ia~r~~~~~~~~~~p~~~~ 175 (315)
T TIGR00675 114 SHDKGRTFKVIIETLEELGYKVYYKVLNAKDFGVPQNRERIYIVGFRDFDDKLNFEFPKPIY 175 (315)
T ss_pred hcccchHHHHHHHHHHhCCCEEEEEEEcHHHCCCCCCccEEEEEEEeCCCcCcCCCCCCCcc
Confidence 99888899999999999999999999999999999999999999999 4432 235666654
|
All proteins in this family for which functions are known are DNA-cytosine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). |
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >KOG1886 consensus BAH domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation | Back alignment and domain information |
|---|
| >smart00298 CHROMO Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 782 | ||||
| 4ft2_A | 784 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 0.0 | ||
| 4fsx_A | 784 | Crystal Structure Of Se-Substituted Zea Mays Zmet2 | 0.0 | ||
| 3swr_A | 1002 | Structure Of Human Dnmt1 (601-1600) In Complex With | 8e-40 | ||
| 3pta_A | 956 | Crystal Structure Of Human Dnmt1(646-1600) In Compl | 8e-40 | ||
| 3av4_A | 1330 | Crystal Structure Of Mouse Dna Methyltransferase 1 | 9e-38 | ||
| 3pt6_A | 954 | Crystal Structure Of Mouse Dnmt1(650-1602) In Compl | 1e-37 | ||
| 3pt9_A | 873 | Crystal Structure Of Mouse Dnmt1(731-1602) In The F | 2e-37 | ||
| 3g7u_A | 376 | Crystal Structure Of Putative Dna Modification Meth | 5e-09 | ||
| 4hae_A | 81 | Crystal Structure Of The Cdyl2-Chromodomain Length | 6e-07 | ||
| 2uyh_A | 327 | Hhai Dna Methyltransferase S87q-Q237s Mutant Comple | 8e-07 | ||
| 1mht_A | 327 | Covalent Ternary Structure Of Hhai Methyltransferas | 1e-06 | ||
| 1svu_A | 327 | Structure Of The Q237w Mutant Of Hhai Dna Methyltra | 1e-06 | ||
| 1fjx_A | 327 | Structure Of Ternary Complex Of Hhai Methyltransfer | 2e-06 | ||
| 2i9k_A | 327 | Engineered Extrahelical Base Destabilization Enhanc | 2e-06 | ||
| 3qo2_A | 64 | Structural Insights For Mpp8 Chromodomain Interacti | 2e-06 | ||
| 3lwe_A | 62 | The Crystal Structure Of Mpp8 Length = 62 | 3e-06 | ||
| 2zcj_A | 327 | Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos | 3e-06 | ||
| 2uz4_A | 327 | Hhai Dna Methyltransferase R165n Mutant Complex Wit | 6e-06 | ||
| 2uyc_A | 327 | Hhai Dna Methyltransferase R163n Mutant Complex Wit | 6e-06 | ||
| 2z6u_A | 327 | Ternary Structure Of The Glu119ala M.Hhai, C5-Cytos | 7e-06 | ||
| 2z6q_A | 327 | Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D | 9e-06 | ||
| 2z6a_A | 327 | S-Adenosyl-L-Methionine-Dependent Methyl Transfer: | 2e-05 | ||
| 1g55_A | 343 | Structure Of Human Dnmt2, An Enigmatic Dna Methyltr | 2e-05 | ||
| 2dnt_A | 78 | Solution Structure Of Rsgi Ruh-064, A Chromo Domain | 2e-05 | ||
| 1dct_A | 324 | Dna (Cytosine-5) Methylase From Haeiii Covalently B | 2e-04 |
| >pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 Peptide And Sah Length = 784 | Back alignment and structure |
|
| >pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In Complex With Sah Length = 784 | Back alignment and structure |
| >pdb|3SWR|A Chain A, Structure Of Human Dnmt1 (601-1600) In Complex With Sinefungin Length = 1002 | Back alignment and structure |
| >pdb|3PTA|A Chain A, Crystal Structure Of Human Dnmt1(646-1600) In Complex With Dna Length = 956 | Back alignment and structure |
| >pdb|3AV4|A Chain A, Crystal Structure Of Mouse Dna Methyltransferase 1 Length = 1330 | Back alignment and structure |
| >pdb|3PT6|A Chain A, Crystal Structure Of Mouse Dnmt1(650-1602) In Complex With Dna Length = 954 | Back alignment and structure |
| >pdb|3PT9|A Chain A, Crystal Structure Of Mouse Dnmt1(731-1602) In The Free State Length = 873 | Back alignment and structure |
| >pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 | Back alignment and structure |
| >pdb|4HAE|A Chain A, Crystal Structure Of The Cdyl2-Chromodomain Length = 81 | Back alignment and structure |
| >pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 | Back alignment and structure |
| >pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 | Back alignment and structure |
| >pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 | Back alignment and structure |
| >pdb|3QO2|A Chain A, Structural Insights For Mpp8 Chromodomain Interaction With Histone H3 Lysine 9 Length = 64 | Back alignment and structure |
| >pdb|3LWE|A Chain A, The Crystal Structure Of Mpp8 Length = 62 | Back alignment and structure |
| >pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 | Back alignment and structure |
| >pdb|1G55|A Chain A, Structure Of Human Dnmt2, An Enigmatic Dna Methyltransferase Homologue Length = 343 | Back alignment and structure |
| >pdb|2DNT|A Chain A, Solution Structure Of Rsgi Ruh-064, A Chromo Domain From Human Cdna Length = 78 | Back alignment and structure |
| >pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 782 | |||
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 2e-67 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 2e-41 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 9e-31 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 2e-64 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 5e-34 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 2e-28 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 3e-45 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 5e-12 | |
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 9e-25 | |
| 1dct_A | 324 | Protein (modification methylase HAEIII); enzyme, c | 2e-19 | |
| 1dct_A | 324 | Protein (modification methylase HAEIII); enzyme, c | 1e-07 | |
| 1dct_A | 324 | Protein (modification methylase HAEIII); enzyme, c | 9e-07 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 2e-16 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 1e-10 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 3e-09 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 7e-16 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 4e-06 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 3e-15 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 1e-05 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 8e-15 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 3e-07 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 6e-06 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 2e-14 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 2e-14 | |
| 3lwe_A | 62 | M-phase phosphoprotein 8; MPP8, structural genomic | 3e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 3g7l_A | 61 | Chromo domain-containing protein 1; chromodomain, | 7e-13 | |
| 3fdt_A | 59 | Chromobox protein homolog 5; chromobox homolog5, C | 2e-11 | |
| 1pdq_A | 72 | Polycomb protein; methyllysine, chromodomain, poly | 3e-11 | |
| 1q3l_A | 69 | Heterochromatin protein 1; chromodomain, HP1, chro | 3e-11 | |
| 1ap0_A | 73 | Modifier protein 1; chromatin-binding, protein int | 6e-11 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 1e-10 | |
| 3f2u_A | 55 | Chromobox protein homolog 1; human chromobox homol | 2e-10 | |
| 2dnv_A | 64 | Chromobox protein homolog 8; chromo domain, histon | 2e-10 | |
| 2k1b_A | 73 | Chromobox protein homolog 7; alpha/beta protein, c | 5e-10 | |
| 3h91_A | 54 | Chromobox protein homolog 2; human chromobox homol | 5e-10 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 7e-10 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 4e-06 | |
| 2d9u_A | 74 | Chromobox protein homolog 2 (isoform 2); chromobox | 1e-09 | |
| 2kvm_A | 74 | Chromobox protein homolog 7; histone modification, | 1e-09 | |
| 1pfb_A | 55 | Polycomb protein; chromatin, histone methylation, | 2e-09 | |
| 3i91_A | 54 | Chromobox protein homolog 8; chromobox homolog 8, | 7e-09 | |
| 3mts_A | 64 | Histone-lysine N-methyltransferase SUV39H1; histon | 1e-08 | |
| 2epb_A | 68 | Chromodomain-helicase-DNA-binding protein 6; struc | 2e-07 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 1e-04 | |
| 2h1e_A | 177 | Chromo domain protein 1; CHD1, tandem chromodomain | 3e-04 |
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
Score = 240 bits (612), Expect = 2e-67
Identities = 111/392 (28%), Positives = 172/392 (43%), Gaps = 49/392 (12%)
Query: 425 EKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMD 484
+ + T R LP GDV+ +CGGPPCQG SG NRF + KN ++ F+
Sbjct: 598 KLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNS--RTYSKFKNSLVVSFLS 655
Query: 485 VIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRV 544
+Y +P++ L+ENV + + F + + + LV M YQ G++ AG YG+ Q R R
Sbjct: 656 YCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRA 715
Query: 545 FLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEIIVAYANN--QPCQLEKGVLLSDAISD 602
+ A P +KLP +P P H R + + +N + + + D +SD
Sbjct: 716 IILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSD 775
Query: 603 LPLVTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNND 662
LP V N S E Y ++ FQ+ +R ++ +L DH ++
Sbjct: 776 LPEVRNGASALEISYNGEPQSWFQRQLRGAQYQ-------------PILRDHICKDMSAL 822
Query: 663 DYERVCCIPKRKGANFRDLPGVLV----GPDNKVRWDPSMERVMLKSGKPLVPDYAMKFE 718
R+ IP G+++RDLP + V G + +R +S + E
Sbjct: 823 VAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVE 882
Query: 719 --------------------------HQSSTKPFGRLWWDEIVNTVVTRAQPHNRI--LL 750
H +GRL WD +T VT +P + +L
Sbjct: 883 AGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVL 942
Query: 751 HPSQDRVLTIRENARLQGFPDCYQLFGPVKER 782
HP Q RV+++RE AR QGFPD Y+LFG + ++
Sbjct: 943 HPEQHRVVSVRECARSQGFPDTYRLFGNILDK 974
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Length = 78 | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Length = 70 | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} PDB: 3r93_A* 3svm_A* 3qo2_A* Length = 62 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Length = 61 | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Length = 59 | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 72 | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Length = 69 | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Length = 73 | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Length = 55 | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Length = 64 | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Length = 73 | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} PDB: 2k28_A 3i8z_A Length = 54 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Length = 74 | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 55 | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} PDB: 3gv6_A* 3i90_A* Length = 54 | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 | Back alignment and structure |
|---|
| >2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Length = 177 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 782 | |||
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 100.0 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 100.0 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 100.0 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 100.0 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 100.0 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 100.0 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 100.0 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 100.0 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 100.0 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 100.0 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 100.0 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 100.0 | |
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 99.93 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.92 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.92 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.88 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.72 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.65 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 98.78 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 98.77 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.51 | |
| 2rso_A | 92 | Chromatin-associated protein SWI6; chromodomain, s | 97.89 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 97.88 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 97.79 | |
| 2rsn_A | 75 | Chromo domain-containing protein 1; chromodomain, | 97.78 | |
| 3lwe_A | 62 | M-phase phosphoprotein 8; MPP8, structural genomic | 97.59 | |
| 4hae_A | 81 | CDY-like 2, chromodomain Y-like protein 2; protein | 97.59 | |
| 3fdt_A | 59 | Chromobox protein homolog 5; chromobox homolog5, C | 97.5 | |
| 3f2u_A | 55 | Chromobox protein homolog 1; human chromobox homol | 97.47 | |
| 2dnv_A | 64 | Chromobox protein homolog 8; chromo domain, histon | 97.3 | |
| 1q3l_A | 69 | Heterochromatin protein 1; chromodomain, HP1, chro | 97.29 | |
| 1ap0_A | 73 | Modifier protein 1; chromatin-binding, protein int | 97.27 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 97.27 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 97.27 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 97.24 | |
| 3g7l_A | 61 | Chromo domain-containing protein 1; chromodomain, | 97.19 | |
| 2k1b_A | 73 | Chromobox protein homolog 7; alpha/beta protein, c | 97.19 | |
| 1pdq_A | 72 | Polycomb protein; methyllysine, chromodomain, poly | 97.16 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.11 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.0 | |
| 2d9u_A | 74 | Chromobox protein homolog 2 (isoform 2); chromobox | 96.92 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 96.84 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 96.82 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.75 | |
| 3i91_A | 54 | Chromobox protein homolog 8; chromobox homolog 8, | 96.74 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.74 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.67 | |
| 3mts_A | 64 | Histone-lysine N-methyltransferase SUV39H1; histon | 96.66 | |
| 2kvm_A | 74 | Chromobox protein homolog 7; histone modification, | 96.63 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 96.58 | |
| 3h91_A | 54 | Chromobox protein homolog 2; human chromobox homol | 96.57 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 96.54 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 96.48 | |
| 1pfb_A | 55 | Polycomb protein; chromatin, histone methylation, | 96.47 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.46 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.21 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.08 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 96.01 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 95.99 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 95.87 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 95.85 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 95.78 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 95.72 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 95.71 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 95.68 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 95.55 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.54 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.4 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 95.38 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 95.29 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 95.27 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 95.16 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 95.16 | |
| 1x3p_A | 54 | Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot | 95.14 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 95.13 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 95.11 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 95.05 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 95.05 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 95.01 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 94.96 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 94.92 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 94.89 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 94.89 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 94.81 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 94.61 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 94.52 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 94.49 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 94.39 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 94.15 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 94.13 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 94.1 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 94.08 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 94.05 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 93.99 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 93.98 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 93.8 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 93.65 | |
| 2epb_A | 68 | Chromodomain-helicase-DNA-binding protein 6; struc | 93.62 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 93.52 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 93.47 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 93.32 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 93.16 | |
| 2b2y_C | 115 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 93.13 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 93.07 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 93.03 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 92.76 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 92.39 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 92.17 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 92.13 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 91.92 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 91.71 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 91.64 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 91.62 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 91.52 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 91.21 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 91.07 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 90.99 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 90.83 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 90.72 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 90.38 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 89.9 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 89.75 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 89.47 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 89.05 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 88.93 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 88.91 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 88.75 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 88.47 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 88.41 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 88.16 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 87.92 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 87.83 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 87.83 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 87.62 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 87.6 | |
| 2ee1_A | 64 | Chromodomain helicase-DNA-binding protein 4; EC 3. | 87.47 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 87.35 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 87.27 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 87.2 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 86.99 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 86.98 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 86.94 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 86.85 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 86.78 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 86.67 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 86.58 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 86.27 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 86.24 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 86.07 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 85.98 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 85.93 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 85.92 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 85.85 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 85.8 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 85.8 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 85.76 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 85.75 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 85.47 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 85.36 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 85.12 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 85.11 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 85.09 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 85.06 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 84.91 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 84.65 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 84.43 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 84.3 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 84.13 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 84.04 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 83.82 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 83.78 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 83.68 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 83.66 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 83.38 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 83.29 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 83.07 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 82.97 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 82.88 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 82.86 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 82.7 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 82.64 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 82.52 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 82.42 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 82.4 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 82.26 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 82.21 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 82.19 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 81.95 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 81.95 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 81.87 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 81.62 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 81.59 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 81.48 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 81.4 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 81.12 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 81.06 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 81.02 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 81.0 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 80.61 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 80.55 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 80.44 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 80.23 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 80.05 |
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=8.1e-112 Score=1024.52 Aligned_cols=698 Identities=58% Similarity=1.024 Sum_probs=568.1
Q ss_pred CCCceEcCCCcchhhhhccCccchhch-----hhHHHhhcccceeeEEEECCEEEeeCCEEEEeeCCCCccEEEEEeEEe
Q 003974 67 DSDLFFVSPPVSADEALKRYPDRYKAL-----NEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELF 141 (782)
Q Consensus 67 ~~~~~w~G~p~~~~~~~~~w~~ry~~~-----~~~~~~~~~r~~Y~~~~v~G~~y~vGD~V~v~~~~~~~~~Ia~I~~m~ 141 (782)
..+.+|+|+|++..+++.+||+||... .+++++++.||||+++.++|+.|+|||||||+++++.++|||+|.+||
T Consensus 4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~v~~~~~~~~~i~~i~~~~ 83 (784)
T 4ft4_B 4 DHEPEFIGSPVAADEARSNWPKRYGRSTAAKKPDEEEELKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFF 83 (784)
T ss_dssp -CCCEECSSCCCHHHHHHHCGGGCC------------CCCEEEECSEEEETTEEEETTCEEEECCSTTSCCEEEEEEEEE
T ss_pred CCCccccCCcCChHHHhhcCcccccccccCCCccchhccccceeeeeeeECCEEEeCCCeEEEeCCCCCCCEEEEEEEEE
Confidence 457899999999999999999999983 355567889999999999999999999999999878899999999999
Q ss_pred ecCCCceEEEEEEEEecccccccc------ccccCCCCeEEEeCCcCCccccccceeeEEEeeCCcchhhhhhcCCCCCc
Q 003974 142 ESVDGEPYFKARWFYRAEDTVIKD------LACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPCD 215 (782)
Q Consensus 142 e~~~g~~~v~v~WfyRp~dtv~~~------~~~~~~~rELFlS~~~d~~~~~~I~gkc~V~~~~~~~~~~~~~~~~~~~~ 215 (782)
++.+|..+|+||||||++||+++. ....+|+||||+|+++++|+++||.|||+|++.++..+.+...+..+.|+
T Consensus 84 ~~~~~~~~~~~~~~~r~~d~~~~~~~~~~~~~~~~d~~~~~~s~~~~~~~~~~i~~k~~v~~~~~~~~~~~~~~~~~~~~ 163 (784)
T 4ft4_B 84 EGTDQCHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAKAQLIESCD 163 (784)
T ss_dssp EETTSCEEEEEEEEEEGGGSTTGGGGGCCBTTBCCCTTBEEEEEEEEEEEGGGEEEECCEEECCTTSCHHHHHHHHHHCS
T ss_pred EcCCCCEEEEEEEeeChhhhcccccccccccccccccceEEEeCcEEEechHHeeeeEEEEeeCccccchhhhhccCCcc
Confidence 999999999999999999998654 34567999999999999999999999999999998877777667778999
Q ss_pred eeeeccccCCCceeeecCCcCCCCCCCCCCccccCC---CCCCCCCCCCcceeccccccchhHHHHHHhhhhcCCceeeE
Q 003974 216 LYYDMKYTLPHLTFLNINNESNRRDSDASSTISSET---GSNSPIGQPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTR 292 (782)
Q Consensus 216 ffy~~~Y~~~~~~F~~lp~e~~~~~s~~~~~~~~~~---~~~~~~~~~~~~~ldlf~G~Gg~s~Gl~~g~~~aG~~~~~~ 292 (782)
|||++.|...+.+|..++.+....++...+...++. +....+.+++|++|||||||||||+||+++...+|..+.++
T Consensus 164 ~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~ltvIDLFAG~GGls~Gfe~AG~~~~~~f~vv 243 (784)
T 4ft4_B 164 LYYDMSYSVAYSTFANISSENGQSGSDTASGISSDDVDLETSSSMPTRTATLLDLYSGCGGMSTGLCLGAALSGLKLETR 243 (784)
T ss_dssp EEESEEEETGGGEEEEC-----------------------------CEEEEEEEETCTTSHHHHHHHHHHHHHTEEEEEE
T ss_pred eEeccccCccccCccCCCcccccccccccccccccccccccccccCCCCCeEEEeCcCccHHHHHHHHhCcccCCceeEE
Confidence 999999999999999999887766654444333322 12223677899999999999999999976555555555677
Q ss_pred EEEecCHHHHHHHHHhCCCCcccccchHHHHHHHHHHHHHhhhhcccCCCCCcccccccCchhhhhhhhhhhcccCCCCC
Q 003974 293 WAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANV 372 (782)
Q Consensus 293 ~ave~~~~a~~t~~~N~p~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 372 (782)
||||+|+.|++||++|||++.++++|+.+|+..+.+|..+|..+....... .......+ ......
T Consensus 244 ~AvE~d~~A~~Ty~~Nhp~~~~~~~di~~i~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~------------~~~~~~ 308 (784)
T 4ft4_B 244 WAVDFNSFACQSLKYNHPQTEVRNEKADEFLALLKEWAVLCKKYVQDVDSN---LASSEDQA------------DEDSPL 308 (784)
T ss_dssp EEEESCHHHHHHHHHHCTTSEEEESCHHHHHHHHHHHHHHHHHTC-----------------------------------
T ss_pred EEEeCCHHHHHHHHHHCCCCceecCcHHHhhhhhhhccccccccccccccc---cccccccc------------cccccc
Confidence 999999999999999999999999999999999999999988875311100 00000000 001111
Q ss_pred CchhHHHHHHHHHhcCCCCCCCCCcceeEEeeccCCCCCCCcccccccchhhhhhHHhHhccccccCCCCCCCccEEEec
Q 003974 373 PNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGG 452 (782)
Q Consensus 373 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~vDvl~gg 452 (782)
..+++..+++.+++.+.+. ...++.+++.|.++....++|+++..+.++.+.|.+++..+....++|.+|+||||+||
T Consensus 309 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~i~~~~~~~~~~~~~~~~G~VDvl~GG 386 (784)
T 4ft4_B 309 DKDEFVVEKLVGICYGGSD--RENGIYFKVQWEGYGPEEDTWEPIDNLSDCPQKIREFVQEGHKRKILPLPGDVDVICGG 386 (784)
T ss_dssp ---CCCEEEEEEEEESCSS--SCSSEEEEEEETTCCTTSCEEEESGGGTTCHHHHHHHHHHHHHHTSSCCTTSCSEEEEC
T ss_pred ccccchhhhhccccccccc--ccccccchhhhcccccccccccccccccccchhccccccccchhhccCCCCCeEEEEec
Confidence 2223333445556666654 46789999999999999999999999999999999999999999999999999999999
Q ss_pred CCchhhcccCcCCCCCccccccccchHHHHHHHHHHhCCcEEEeccccccccccccchHHHHHHHHhcCCcceEEEEEec
Q 003974 453 PPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLMENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAA 532 (782)
Q Consensus 453 pPCQ~fS~ag~~~~~~~~~~d~r~~L~~~~~~ii~~~~P~~~v~ENV~gl~~~~~~~~~~~i~~~l~~~GY~v~~~ilnA 532 (782)
||||+||.||++++...+.+|+||.||++|+++|+.++|++||||||+||+++.++..++.++..|..+||++.+.+|||
T Consensus 387 pPCQ~FS~aG~~kg~~~~~~D~R~~L~~~~~riv~~~rPk~fvlENV~glls~~~g~~~~~il~~l~~lGY~v~~~vLnA 466 (784)
T 4ft4_B 387 PPCQGISGFNRYRNRDEPLKDEKNKQMVTFMDIVAYLKPKYVLMENVVDILKFADGYLGKYALSCLVAMKYQARLGMMVA 466 (784)
T ss_dssp CCCCSSSGGGGGSCTTSTTTSTTCHHHHHHHHHHHHHCCSEEEEEEEGGGGTGGGGHHHHHHHHHHHHTTCEEEEEEEEG
T ss_pred CCCcchhhhhcccCcCccccCchhHHHHHHHHHHHHHCCCEEEEEecCCccccccchHHHHHHHHHHhCCCeeeeeecCH
Confidence 99999999999887767789999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCccccEEEEEEecCCCCCCCCCCCccccccccCCCchhHHHHHhhcCCCCccccCcccHHhhhccCCCCCCCCCc
Q 003974 533 GSYGLPQFRLRVFLWGARPFKKLPQYPLPTHEIVARGVIPNEFQEIIVAYANNQPCQLEKGVLLSDAISDLPLVTNNESE 612 (782)
Q Consensus 533 ~~yGvPQ~R~R~flig~~~~~~~p~~P~pth~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~tv~dAI~dLp~~~~~~~~ 612 (782)
++|||||+|+|+||||++++..+|.+|.|||....+...+..+......+.......+.+.+|+++||+|||.+.++...
T Consensus 467 ~dyGVPQ~R~Rvfivg~r~d~~~~~~P~pth~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~dai~dlp~~~~~~~~ 546 (784)
T 4ft4_B 467 GCYGLPQFRMRVFLWGALSSMVLPKYPLPTYDVVVRGGAPNAFSQCMVAYDETQKPSLKKALLLGDAISDLPKVQNHQPN 546 (784)
T ss_dssp GGGTCSSCCEEEEEEEECTTSCCCCEECCSBCCCCCSCSCGGGTTCBCSCCTTCCCCCBCCCCHHHHHTTSCCCCSCCCC
T ss_pred HHcCCCcccccceeeeeccCCCcccCCCcccccccccccccccccccccccccccccccccccHHHHhhcccccccCCCc
Confidence 99999999999999999999999999999998766655555444433333334445667889999999999999998888
Q ss_pred cccccCCccchHHHHHHHhhcccccccccccc-cCCCCccCCCCccCCCHHHHHHHccCcccCCCCccCCCCCccCCCCC
Q 003974 613 DERKYGTVARTEFQKYIRLRRHDVVNLSSAQM-ASRPSLLYDHRPFQVNNDDYERVCCIPKRKGANFRDLPGVLVGPDNK 691 (782)
Q Consensus 613 ~~~~y~~~p~t~~~~~~r~~~~~~~~~~~~~~-~~~~~~l~~H~~~~~~~~~~~ri~~ip~~~G~~~rdlp~~~~~~~~~ 691 (782)
..+.|...+.+.|+++++...........+.. ......+.+|.+..++...++++..||...|.+|++++.........
T Consensus 547 ~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~r~~~i~~~~g~~~~dl~~~~~~~~~~ 626 (784)
T 4ft4_B 547 DVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEGAGPDEGKLLDHQPLRLNNDDYERVQQIPVKKGANFRDLKGVRVGANNI 626 (784)
T ss_dssp SEECCSSCCCSHHHHHHTCCTTTTTCCTTCSSCCSSTTCEECCCCCCCCHHHHHHHHHSCSSTTCCGGGSTTEEECGGGC
T ss_pred cccccCCCCccHHHHHHhhcccccccccccccccccccccccccccccCHHHHHHHHhcccccCCccccccccccccccc
Confidence 88899999999999999976655443333221 13345688999999999999999999999999999999877655555
Q ss_pred cccCcchhhhhhcCCCCCCcccccccccCCCCCCeeeccCCCcccceecccCCCCCcccCCCCCccCcHHHHHHhcCCCC
Q 003974 692 VRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKPFGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPD 771 (782)
Q Consensus 692 ~~~~~~~~~~~l~~gk~l~p~~~~~~~~~~~~~~y~Rl~wd~p~pTItt~~~~~~~~~iHP~q~R~LTVREaARLQgFPD 771 (782)
..+.+...+..+.+|+.+.+.....+..+.+.+.|+||.||+|++||||++.++++.++||.|+|.||||||||||||||
T Consensus 627 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~rl~~d~ps~TItt~~~~~~~~~iHp~~~R~LTpRE~ARLQgFPD 706 (784)
T 4ft4_B 627 VEWDPEIERVKLSSGKPLVPDYAMSFIKGKSLKPFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPD 706 (784)
T ss_dssp EEECTTSCCCBCTTSSBSSCHHHHHGGGGTCCCTTEECCTTCCCSCCCSCCCSSSSEEECSSSSSBCCHHHHHHHTTCCT
T ss_pred ccccchhhhcccccCcccccccccccccCCcCccceeccCCCcccceeccccCCCCeecCCCCCcCCcHHHHHHHCCCCC
Confidence 55666666677788888888888777888899999999999999999999998889999999999999999999999999
Q ss_pred CcEEcCCCCC
Q 003974 772 CYQLFGPVKE 781 (782)
Q Consensus 772 ~y~F~Gs~~~ 781 (782)
+|.|.|+.++
T Consensus 707 ~y~f~Gs~~~ 716 (784)
T 4ft4_B 707 YYRLFGPIKE 716 (784)
T ss_dssp TCCCCSCHHH
T ss_pred CCEeCCCHHH
Confidence 9999998653
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* | Back alignment and structure |
|---|
| >4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 782 | ||||
| d1g6za_ | 70 | b.34.13.2 (A:) Histone methyltransferase clr4, chr | 3e-13 | |
| d2dnta1 | 66 | b.34.13.2 (A:8-73) Chromodomain protein, Y-like is | 6e-12 | |
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 7e-11 | |
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 3e-09 | |
| d2b2ya1 | 80 | b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 | 9e-11 | |
| d1guwa_ | 73 | b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou | 2e-10 | |
| d1q3la_ | 52 | b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru | 2e-10 | |
| d2dnva1 | 52 | b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo | 3e-10 | |
| d2dy8a1 | 69 | b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 | 1e-09 | |
| d1pfba_ | 55 | b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr | 5e-09 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 9e-09 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 9e-08 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 3e-04 | |
| d1m4za_ | 217 | b.34.12.1 (A:) Origin-recognition complex protein | 7e-08 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 8e-08 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 2e-07 | |
| d2dy7a1 | 81 | b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 | 2e-06 | |
| d2b2ya2 | 95 | b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( | 0.004 |
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Chromo domain-like family: Chromo domain domain: Histone methyltransferase clr4, chromo domain species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Score = 62.9 bits (153), Expect = 3e-13
Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
Query: 373 PNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEF 430
EE+EVER++ +++RW Y DTWEP + LS C L E+
Sbjct: 5 KQEEYEVERIVDEKLDRNGAV----KLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEW 58
|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 782 | |||
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 100.0 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 100.0 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.49 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 97.74 | |
| d2dnva1 | 52 | Chromobox protein homolog 8 {Mouse (Mus musculus) | 97.62 | |
| d1q3la_ | 52 | Heterochromatin protein 1, HP1 {Fruit fly (Drosoph | 97.61 | |
| d2dnta1 | 66 | Chromodomain protein, Y-like isoform {Human (Homo | 97.6 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.55 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.47 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 97.46 | |
| d1guwa_ | 73 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 97.36 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.35 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.31 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 97.3 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.21 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 97.19 | |
| d1g6za_ | 70 | Histone methyltransferase clr4, chromo domain {Fis | 97.03 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 96.99 | |
| d1pfba_ | 55 | Polycomb protein, Pc {Fruit fly (Drosophila melano | 96.98 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 96.86 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 96.51 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 96.39 | |
| d1x3pa1 | 54 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 95.24 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 94.87 | |
| d2dy8a1 | 69 | ATP-dependent helicase CHD1 (Chromo domain protein | 94.29 | |
| d2b2ya1 | 80 | ATP-dependent helicase CHD1 (Chromo domain protein | 94.29 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 94.24 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 93.65 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 91.63 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 91.41 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 91.32 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 91.31 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 91.01 | |
| d2dy7a1 | 81 | ATP-dependent helicase CHD1 (Chromo domain protein | 90.04 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 88.45 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 88.42 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 87.67 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 87.49 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 87.42 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 86.83 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 86.54 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 86.25 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 85.46 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 84.8 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 84.7 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 83.87 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 82.76 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 82.54 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 81.15 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 80.33 |
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNA methylase HhaI species: Haemophilus haemolyticus [TaxId: 726]
Probab=100.00 E-value=5.3e-52 Score=448.42 Aligned_cols=179 Identities=23% Similarity=0.389 Sum_probs=155.5
Q ss_pred CCCCCcceeccccccchhHHHHHHhhhhcCCceeeEEEEecCHHHHHHHHHhCCCCcccccchHHHHHHHHHHHHHhhhh
Q 003974 257 IGQPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYF 336 (782)
Q Consensus 257 ~~~~~~~~ldlf~G~Gg~s~Gl~~g~~~aG~~~~~~~ave~~~~a~~t~~~N~p~~~~~~~d~~~~~~~~~~~~~~~~~~ 336 (782)
.++..|++|||||||||+++|| +.+|+++ +||+|+|+.|++||++|||++. .+||.++
T Consensus 7 ~~~~~lrv~~lFsG~Gg~~~gl----~~aG~~~--v~a~e~d~~a~~~~~~N~~~~~--~~Di~~~-------------- 64 (327)
T d2c7pa1 7 KQLTGLRFIDLFAGLGGFRLAL----ESCGAEC--VYSNEWDKYAQEVYEMNFGEKP--EGDITQV-------------- 64 (327)
T ss_dssp CTTTTCEEEEETCTTTHHHHHH----HHTTCEE--EEEECCCHHHHHHHHHHHSCCC--BSCGGGS--------------
T ss_pred ccCCCCeEEEECccccHHHHHH----HHCCCeE--EEEEeCCHHHHHHHHHHCCCCC--cCchhcC--------------
Confidence 5667899999999999999999 7899985 4999999999999999999865 3555432
Q ss_pred cccCCCCCcccccccCchhhhhhhhhhhcccCCCCCCchhHHHHHHHHHhcCCCCCCCCCcceeEEeeccCCCCCCCccc
Q 003974 337 SIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANVPNEEFEVERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEP 416 (782)
Q Consensus 337 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~ 416 (782)
...
T Consensus 65 ------------------------------------~~~----------------------------------------- 67 (327)
T d2c7pa1 65 ------------------------------------NEK----------------------------------------- 67 (327)
T ss_dssp ------------------------------------CGG-----------------------------------------
T ss_pred ------------------------------------chh-----------------------------------------
Confidence 000
Q ss_pred ccccchhhhhhHHhHhccccccCCCCCCCccEEEecCCchhhcccCcCCCCCccccccccchHHHHHHHHHHhCCcEEEe
Q 003974 417 IKGLSKCKEKLKEFVTKGYRSNILPLPGDVDFICGGPPCQGVSGFNRFRNPQAALEDIKNRQLLVFMDVIEYLKPKYVLM 496 (782)
Q Consensus 417 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~vDvl~ggpPCQ~fS~ag~~~~~~~~~~d~r~~L~~~~~~ii~~~~P~~~v~ 496 (782)
..+++|||+||||||+||.||+++ +.+|+|+.|+.+++++|++++|++|+|
T Consensus 68 -------------------------~~~~~Dll~ggpPCq~fS~ag~~~----g~~d~r~~l~~~~~~~i~~~kP~~~~l 118 (327)
T d2c7pa1 68 -------------------------TIPDHDILCAGFPCQAFSISGKQK----GFEDSRGTLFFDIARIVREKKPKVVFM 118 (327)
T ss_dssp -------------------------GSCCCSEEEEECCCTTTCTTSCCC----GGGSTTSCHHHHHHHHHHHHCCSEEEE
T ss_pred -------------------------hcceeeeeecccccchhhhhhhhc----CCcccchhHHHHHHHHHhccCCcEEec
Confidence 014799999999999999999743 468999999999999999999999999
Q ss_pred ccccccccccccchHHHHHHHHhcCCcceEEEEEecccCCCCccccEEEEEEecCCCCCC--CCCCCcc
Q 003974 497 ENVVDILKFSGGFLARYAVGRLVSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLP--QYPLPTH 563 (782)
Q Consensus 497 ENV~gl~~~~~~~~~~~i~~~l~~~GY~v~~~ilnA~~yGvPQ~R~R~flig~~~~~~~p--~~P~pth 563 (782)
|||+||++...+..++.++..|+++||.+.+.+|||++|||||+|+|+|+||+++++.++ .+|.|++
T Consensus 119 ENV~~~~~~~~~~~~~~i~~~l~~lGY~~~~~vl~a~~~GvPQ~R~R~fivg~r~~~~~~~~~~p~p~~ 187 (327)
T d2c7pa1 119 ENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFE 187 (327)
T ss_dssp EEEGGGGTGGGGHHHHHHHHHHHHTTBCCEEEEEEGGGGTCSBCCEEEEEEEEBGGGCCCCCCCCCCCC
T ss_pred ccchhhhhhccchhhHHhhhHHHhcCCcceeeEecHHHcCCCchhhhheeeeeccCccccccccccccc
Confidence 999999999989999999999999999999999999999999999999999999987643 4555543
|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|