Citrus Sinensis ID: 003992


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-
MNDETQATSSSKAFSFISRSWREVRDSADADIQLMKNRANSFKNLATSFDRELENFLNSANRSSAPAEIDFVKKLQPKISEFRRVYSAPEISKRVLEKWGPRARIRIDLSAIRNAIVSDVDVDAERDGGGIIEFDRGKRGRVGFRELWGEREVGEWEPIRTLKMRLREFERKRELSVEEIFGGFKSSDFVEKVKSSWKAICKEPEESKDVPPLDPTELLAHLVRQSGPFLDHLGVKRDLCDKIVESLCSKRKEQLLLRSIAGGECSVLENDNINDELDLRIASVLQSTGHHYEGGFWTDFGKDDLSDKKRNVAIVTTASLPWMTGTAVNPLFRAAYLAKTEQQNVTLLVPWLCKSDQELVYPNVTFCSPEEQENYMRNWLEERVGFKADFKISFYPGKFSKERRSIIPAGDTSQFIPSKDADIAILEEPEHLNWYHHGKRWTDKFNHVVGVVHTNYLEYIKREKNGALQAFFVKHINNWVTRAYCDKVLRLSAATQDLPKSVICNVHGVNPKFLQIGEKVATDREQGQQAFSKGAYFLGKMVWAKGYRELIDLLAKHKNDLDGFKLDVFGNGEDAYEVQSAAKRLDLNLNFQKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVICADHPSNEFFRSFPNCLTYKTSEDFVARVKEALANDPQPLTPEQRYNLSWEAATQRFIEYSELNRILNNNKDDAKSSRNDGKIIRKSFSVPNLSEVVDGGLAFAHYCFTGNEFLRLCTGAIPGTRDYDKQHCRDLHLLPPQVENPIYGW
cccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHHcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHccccHHccccccEEEEECccccccccccccHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHccccccEEEEECccccHHHHHHHHHHccccCEECccccccHHHHccccEEEccccccccHHHHHHHHHccccEEECcccccccccccccCECcccHHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccc
***************FISRSWREVRDSADADIQLMKNRANSFKNLATSFDRELENFLNSANRSSAPAEIDFVKKLQPKISEFRRVYSAPEISKRVLEKWGPRARIRIDLSAIRNAIVSDVDV******GGIIEFDRGKRGRVGFRELWGEREVGEWEPIRTLKMRLREFERKRELSVEEIFGGFKSSDFVEKVKSSWKAIC***********LDPTELLAHLVRQSGPFLDHLGVKRDLCDKIVESLCSKRKEQLLLRSI*GGECSVLE*DNINDELDLRIASVLQSTGHHYEGGFWTDFGKDDLSDKKRNVAIVTTASLPWMTGTAVNPLFRAAYLAKTEQQNVTLLVPWLCKSDQELVYPNVTFCSPEEQENYMRNWLEERVGFKADFKISFYPGKFSKERRSIIPAGDTSQFIPSKDADIAILEEPEHLNWYHHGKRWTDKFNHVVGVVHTNYLEYIKREKNGALQAFFVKHINNWVTRAYCDKVLRLSAATQDLPKSVICNVHGVNPKFLQIGEKVATDREQGQQAFSKGAYFLGKMVWAKGYRELIDLLAKHKNDLDGFKLDVFGNGEDAYEVQSAAKRLDLNLNFQKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVICADHPSNEFFRSFPNCLTYKTSEDFVARVKEALANDPQPLTPEQRYNLSWEAATQRFIEYSELNRI****************IIRKSFSVPNLSEVVDGGLAFAHYCFTGNEFLRLCTGAIPGTRDYDKQHCRDLHLLPPQV*NPIYGW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDETQATSSSKAFSFISRSWREVRDSADADIQLMKNRANSFKNLATSFDRELENFLNSANRSSAPAEIDFVKKLQPKISEFRRVYSAPEISKRVLEKWGPRARIRIDLSAIRNAIVSDVDVDAERDGGGIIEFDRGKRGRVGFRELWGEREVGEWEPxxxxxxxxxxxxxxxxxxxxxIFGGFKSSDFVEKVKSSWKAICKEPEESKDVPPLDPTELLAHLVRQSGPFLDHLGVKRDLCDKIVESLCSKRKEQLLLRSIAGGECSVLENDNINDELDLRIASVLQSTGHHYEGGFWTDFGKDDLSDKKRNVAIVTTASLPWMTGTAVNPLFRAAYLAKTEQQNVTLLVPWLCKSDQELVYPNVTFCSPEEQENYMRNWLEERVGFKADFKISFYPGKFSKERRSIIPAGDTSQFIPSKDADIAILEEPEHLNWYHHGKRWTDKFNHVVGVVHTNYLEYIKREKNGALQAFFVKHINNWVTRAYCDKVLRLSAATQDLPKSVICNVHGVNPKFLQIGEKVATDREQGQQAFSKGAYFLGKMVWAKGYRELIDLLAKHKNDLDGFKLDVFGNGEDAYEVQSAAKRLDLNLNFQKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVICADHPSNEFFRSFPNCLTYKTSEDFVARVKEALANDPQPLTPEQRYNLSWEAATQRFIEYSELNRILNNNKDDAKSSRNDGKIIRKSFSVPNLSEVVDGGLAFAHYCFTGNEFLRLCTGAIPGTRDYDKQHCRDLHLLPPQVENPIYGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Digalactosyldiacylglycerol synthase 1, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.confidentQ9S7D1
Digalactosyldiacylglycerol synthase 1, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.confidentQ6DW76
Digalactosyldiacylglycerol synthase 1, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.probableQ6DW74

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.241Digalactosyldiacylglycerol synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JJM, chain A
Confidence level:very confident
Coverage over the Query: 311-367,385-700
View the alignment between query and template
View the model in PyMOL
Template: 3OKP, chain A
Confidence level:very confident
Coverage over the Query: 309-355,371-700
View the alignment between query and template
View the model in PyMOL