Citrus Sinensis ID: 004019

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78

MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKER

ccccccccHHHccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

****************************************AVLQFQNQKLVQKLE**KVEYSAL****************TLKVVNKSWEELITDL*******************************************************************KNIVSNILAAVDNLWHLKGGLYAAVLKDL*********************LALMDL***********************************VKELEECNCKLAALRAERD*********************************************QLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQL***KSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQ************************IIAEFRALV***************KYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLK***********V**************************************************AYLSEIETI*************LLQQITERDDYNIKLVLEGVRARQLQDALLMDKHM****IQQANASLNFFDMKAARIENQLRFCLD*******************************************************I*L****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDVTKGAFFPVLNLGNKHVAGDRxxxxxxxxxxxxxxxxxxxxxASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIExxxxxxxxxxxxxxxxxxxxxPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase BRE1-like 1	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6. Required for the regulation of flowering time and defense against necrotrophic fungal pathogens.	probable	Q8RXD6
E3 ubiquitin-protein ligase BRE1-like 1	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.	probable	Q7XU27

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 709-746
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 615-647
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 355-482
View the alignment between query and template
View the model in PyMOL

Template: 3I00, chain A
Confidence level:probable
Coverage over the Query: 321-399
View the alignment between query and template
View the model in PyMOL

Template: 4GKW, chain A
Confidence level:probable
Coverage over the Query: 412-472,483-529
View the alignment between query and template
View the model in PyMOL

Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 185-703
View the alignment between query and template
View the model in PyMOL