Citrus Sinensis ID: 004032

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MAPSLSKNVLDAIGLLDSQIPPSISLEGSNFLANGHPIFTQVPINIIATPSPFTSANKTKHTAGCFVGFDADESSDRHVVPIGKLNGIRFMSIFRFKAWWTTHWVGNSGKDMEHETHLMILDKNDLGRPYVLLLPILEGPFRASLQPGTDNYVDMCVESGSSQIRCSSFRSCLYMRVGDDPYSLVKEAMKVVRVHLGTFKLLEEKTVPGIVDKFGWCTWDAFYLQVHPKGVYEGVKGLVEGGCPPGLVLIDDGWQSICHDDEPIIDQEGMNRTSAGEQMPCRLIDFEENYKFRDYKSPRVPSNKGMGAFVRDLKDEFKSVEHVYVWHALCGYWGGIRPNVAGMPESRLIAPKLSQGLQTTMEDLAVEKIVDNGVGLVPPELVQNLYEGLHSHLESVGIDGVKVDVIHLLEMVAEDFGGRVELAKAYYKALTASVRKHFKGNGVIASMEHCNDFMYLGTETISLGRVGDDFWCSDPKGVKNGTFWLQGCHMVHCAYNSLWMGNVIQPDWDMFQSTHPCAEFHAASRAISGGPIYISDSVGNHNFDLLKALVMPDGSILRCQFYALPTRDCLFENPLHDGKTVLKIWNLNKHTGVLGLFNCQGGGWCSVTRKNVGFSMFSNTLTCLASPNDIEWNNGKDPISVKGVDVFAVYKFQENKLKLLKFSDDLEVTVEPFNFELLTVSPVTVLPKGSIQFAPIGLVNMLNTGGAVQSLAFDDDENLVRIEVKGCGEMKVFASEKPLMCKVDGASAEFSYEDQMATVQVPWPNNSSKLTVVEFLFE
cccccccccccccccccccccccEEECccEEEEccEEccccccccEEEccccccccccccccccEEEEECcccccccCEEEccccccccEEEEEEEccccccccccccccccccccEEEEEECccccccEEEEEEECcccEEEEEcccccccEEEEEEccccccccccccEEEEEECcccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHccccccccHHHHHHHHHHHHccccccEEEEEcccCECcccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHHHHHHcccccEEEEEEHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccCEEEECcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHcccccccEEEECcccccccccccccccccccEEEEEEcccccEEEEEEEcccccccccECcccccccccccEEEcccccccccccccccccccccEEEEEEEEcccEEEEEcccccEEEEEccccEEEEEEEEEEECccccEEEEEEccEEcccccccEEEEEECccccEEEEEEEEEEEEEEEEcccccEEEEccEEEEEEECccEEEEEECccccccccEEEEEEEc
****************DSQIPPSISLEGSNFLANGHPIFTQVPINIIATPSPFTSANKTKHTAGCFVGFDADESSDRHVVPIGKLNGIRFMSIFRFKAWWTTHWVGNSGKDMEHETHLMILDKNDLGRPYVLLLPILEGPFRASLQPGTDNYVDMCVESGSSQIRCSSFRSCLYMRVGDDPYSLVKEAMKVVRVHLGTFKLLEEKTVPGIVDKFGWCTWDAFYLQVHPKGVYEGVKGLVEGGCPPGLVLIDDGWQSICHDDEPIIDQEGMNRTSAGEQMPCRLIDFEENYKFRDYK*******KGMGAFVRDLKDEFKSVEHVYVWHALCGYWGGIRPNVAGMPESRLIAPKLSQGLQTTMEDLAVEKIVDNGVGLVPPELVQNLYEGLHSHLESVGIDGVKVDVIHLLEMVAEDFGGRVELAKAYYKALTASVRKHFKGNGVIASMEHCNDFMYLGTETISLGRVGDDFWCSDPKGVKNGTFWLQGCHMVHCAYNSLWMGNVIQPDWDMFQSTHPCAEFHAASRAISGGPIYISDSVGNHNFDLLKALVMPDGSILRCQFYALPTRDCLFENPLHDGKTVLKIWNLNKHTGVLGLFNCQGGGWCSVTRKNVGFSMFSNTLTCLASPNDIEWNNGKDPISVKGVDVFAVYKFQENKLKLLKFSDDLEVTVEPFNFELLTVSPVTVLPKGSIQFAPIGLVNMLNTGGAVQSLAFDDDENLVRIEVKGCGEMKVFASEKPLMCKVDGASAEFSYEDQMATVQVPWPNNSSKLTVVEFLFE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPSLSKNVLDAIGLLDSQIPPSISLEGSNFLANGHPIFTQVPINIIATPSPFTSANKTKHTAGCFVGFDADESSDRHVVPIGKLNGIRFMSIFRFKAWWTTHWVGNSGKDMEHETHLMILDKNDLGRPYVLLLPILEGPFRASLQPGTDNYVDMCVESGSSQIRCSSFRSCLYMRVGDDPYSLVKEAMKVVRVHLGTFKLLEEKTVPGIVDKFGWCTWDAFYLQVHPKGVYEGVKGLVEGGCPPGLVLIDDGWQSICHDDEPIIDQEGMNRTSAGEQMPCRLIDFEENYKFRDYKSPRVPSNKGMGAFVRDLKDEFKSVEHVYVWHALCGYWGGIRPNVAGMPESRLIAPKLSQGLQTTMEDLAVEKIVDNGVGLVPPELVQNLYEGLHSHLESVGIDGVKVDVIHLLEMVAEDFGGRVELAKAYYKALTASVRKHFKGNGVIASMEHCNDFMYLGTETISLGRVGDDFWCSDPKGVKNGTFWLQGCHMVHCAYNSLWMGNVIQPDWDMFQSTHPCAEFHAASRAISGGPIYISDSVGNHNFDLLKALVMPDGSILRCQFYALPTRDCLFENPLHDGKTVLKIWNLNKHTGVLGLFNCQGGGWCSVTRKNVGFSMFSNTLTCLASPNDIEWNNGKDPISVKGVDVFAVYKFQENKLKLLKFSDDLEVTVEPFNFELLTVSPVTVLPKGSIQFAPIGLVNMLNTGGAVQSLAFDDDENLVRIEVKGCGEMKVFASEKPLMCKVDGASAEFSYEDQMATVQVPWPNNSSKLTVVEFLFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Galactinol--sucrose galactosyltransferase Transglycosidase operating by a ping-pong reaction mechanism. Involved in the synthesis of raffinose, a major soluble carbohydrate in seeds, roots and tubers. Specific for galactinol and p-nitrophenyl-alpha-D-galactoside as galactosyl donors. Able to utilize sucrose, lactose, 4-beta-galactobiose, N-acetyl-D-lactosamine, trehalose and lacto-N-biose as acceptors. May also act as a glycoside hydrolase.probableQ5VQG4
Probable galactinol--sucrose galactosyltransferase 5 Transglycosidase operating by a ping-pong reaction mechanism. Involved in the synthesis of raffinose, a major soluble carbohydrate in seeds, roots and tubers.probableQ9FND9
Galactinol--sucrose galactosyltransferase Transglycosidase operating by a ping-pong reaction mechanism. Involved in the synthesis of raffinose, a major soluble carbohydrate in seeds, roots and tubers. Able to utilize D-ononitol and D-pinitol as acceptors. May also act as a glycoside hydrolase.probableQ8VWN6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.82Galactinol--sucrose galactosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZY9, chain A
Confidence level:very confident
Coverage over the Query: 130-259,285-293,304-560,573-601
View the alignment between query and template
View the model in PyMOL
Template: 3CC1, chain A
Confidence level:very confident
Coverage over the Query: 213-344,357-603,619-632,643-683
View the alignment between query and template
View the model in PyMOL
Template: 3A21, chain A
Confidence level:confident
Coverage over the Query: 211-263,282-293,304-356,374-603,619-685
View the alignment between query and template
View the model in PyMOL
Template: 4FNQ, chain A
Confidence level:confident
Coverage over the Query: 114-262,281-293,304-474,487-561,574-601
View the alignment between query and template
View the model in PyMOL