Citrus Sinensis ID: 004054

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770------
MIFHKLSLVFPLLCLCFTSLLTRVDSTQPPFSCDPSNPSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPAYEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALYNAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDTFNGGKLKGKLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPFESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRQWGFHGYITSDCDAVSIIYDAEGYAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLFNGNPTMQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKYDRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATSGNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKAVSQNKLYLNQSSSTKMVENQDVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVKPARRGNGRPIKQLVGFQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHFLVVGDEEYPISIFV
ccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHccccccEEEEcccHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcEEEccccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHcccccEECccccccccccccHHHHHHHHHcccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEccccccccEEEEEECcccccccccccccccccEEEEccccEEEEEEEEccccccEEEcccccEEEEccEEEEEEcccccCEEEEc
*IFHKLSLVFPLLCLCFTSLLTRVDSTQPPFSC****PSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPAYEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALYNAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDTFNGGKLKGKLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPFESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRQWGFHGYITSDCDAVSIIYDAEGYAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLFNGNPTMQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKYDRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATSGNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKAVSQN*******SSTKMVENQDVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVKPARRGNGRPIKQLVGFQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHFLVVGDEEYPISIFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFHKLSLVFPLLCLCFTSLLTRVDSTQPPFSCDPSNPSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPAYEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALYNAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDTFNGGKLKGKLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPFESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRQWGFHGYITSDCDAVSIIYDAEGYAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLFNGNPTMQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKYDRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATSGNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKAVSQNKLYLNQSSSTKMVENQDVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVKPARRGNGRPIKQLVGFQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHFLVVGDEEYPISIFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable beta-D-xylosidase 7 probableQ9SGZ5
Probable exo-1,4-beta-xylosidase xlnD Xylan 1,4-beta-xylosidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose.probableA2QA27
Probable exo-1,4-beta-xylosidase bxlB Xylan 1,4-beta-xylosidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose.probableQ4WFI6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.37Xylan 1,4-beta-xylosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ABZ, chain A
Confidence level:very confident
Coverage over the Query: 53-198,210-303,318-646,681-774
View the alignment between query and template
View the model in PyMOL
Template: 3RRX, chain A
Confidence level:very confident
Coverage over the Query: 50-100,111-468,483-601,616-640
View the alignment between query and template
View the model in PyMOL
Template: 3ZYZ, chain A
Confidence level:very confident
Coverage over the Query: 52-100,111-198,210-302,317-774
View the alignment between query and template
View the model in PyMOL
Template: 2X40, chain A
Confidence level:confident
Coverage over the Query: 54-198,210-299,311-651,665-668,689-766
View the alignment between query and template
View the model in PyMOL