Citrus Sinensis ID: 004081


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-----
MQGVCHLLTSIGIYCKEALSSCSAYELPCLDDSSNELEALSEYENMDLENIVFEKVNKEIEARKKASEEVSFHLHAPKALFGLVEDIKVSAVSKSQGGDKCREASPSAHAPNDAMREFDSISGAFLRTNWQMQGYLMEQADAIEKHGSSFSLNAFELILRQLQKLAPELHRVHFLRYLNSLYHDDYFAALENLHRYFDYSAGTEGFDFAQPSIGCNSFGRYEIALLCLGMMHFHFGHPKQALDVLTEAVCLSQQHSNDTCLAYTLAAISNLLSEIGISTTTGILGSSYSPITSIGTTLSVQQQLFVLLKESFRRAESLKLKRLVAANHLAMAKFDLTHVQRPLLSFGPKTAMRLRTCPTNVCKELRLASHLISDFVSESSTMTTDGAFSTSWLKNLQKPMGSLVLTQENVSGKDSNAFQFCAQPSSIPGSVLQLVGSSYLLRATAWEAYGSAPLTRVNTLIYATCFSDGSSLSDAALAHVKLIQHLAVFKGYKEAFSALKIAEEKFLSVSKSRILLLKLQLLHERSLHRGHLKLAQKVCDELGVMASSVTGVDMDLKTEASLRHARTLLAANQFSEAAAVAHSLFCMCYKFNLQVENASVLLLLAEIHKKSGNAVLGIPYALASLSFCQLLNLDLLKASATLTLAELWLSFGPNHAKMASNLIQQALPLILGHGGLELRARAFIAEAKCLLSDPSFSVSQNPEAVLDPLRQASEELQVLEDHELAAEAFYLIAIVFDKLGRLAEREEAAALFKEYVLALENENRQDEVDPLLSTP
ccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccHHHHHHHHcccccccHHHHHcccccccHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccc
*QGVCHLLTSIGIYCKEALSSCSAYELPCLDDSSNELEALSEYENMDLENIVFEKVNKE**********VSF*******LFGLVEDIKV**********************************AFLRTNWQMQGYLMEQADAIEKHGSSFSLNAFELILRQLQKLAPELHRVHFLRYLNSLYHDDYFAALENLHRYFDYSAGTEGFDFAQPSIGCNSFGRYEIALLCLGMMHFHFGHPKQALDVLTEAVCLSQQHSNDTCLAYTLAAISNLLSEIGISTTTGILGSSYSPITSIGTTLSVQQQLFVLLKESFRRAESLKLKRLVAANHLAMAKFDLTHVQRPLLSFGPKTAMRLRTCPTNVCKELRLASHLISDFVSESSTMTTDGAFSTSWLKNLQKPMGSLV*T********SNAFQFCAQPSSIPGSVLQLVGSSYLLRATAWEAYGSAPLTRVNTLIYATCFSDGSSLSDAALAHVKLIQHLAVFKGYKEAFSALKIAEEKFLSVSKSRILLLKLQLLHERSLHRGHLKLAQKVCDELGVMASSVTGVDMDLKTEASLRHARTLLAANQFSEAAAVAHSLFCMCYKFNLQVENASVLLLLAEIHKKSGNAVLGIPYALASLSFCQLLNLDLLKASATLTLAELWLSFGPNHAKMASNLIQQALPLILGHGGLELRARAFIAEAKCLLSD**********AVLDPLRQASEELQVLEDHELAAEAFYLIAIVFDKLGRLAEREEAAALFKEYVLALE***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGVCHLLTSIGIYCKEALSSCSAYELPCLDDSSNELEALSEYENMDLENIVFEKVNKEIEARKKASEEVSFHLHAPKALFGLVEDIKVSAVSKSQGGDKCREASPSAHAPNDAMREFDSISGAFLRTNWQMQGYLMEQADAIEKHGSSFSLNAFELILRQLQKLAPELHRVHFLRYLNSLYHDDYFAALENLHRYFDYSAGTEGFDFAQPSIGCNSFGRYEIALLCLGMMHFHFGHPKQALDVLTEAVCLSQQHSNDTCLAYTLAAISNLLSEIGISTTTGILGSSYSPITSIGTTLSVQQQLFVLLKESFRRAESLKLKRLVAANHLAMAKFDLTHVQRPLLSFGPKTAMRLRTCPTNVCKELRLASHLISDFVSESSTMTTDGAFSTSWLKNLQKPMGSLVLTQENVSGKDSNAFQFCAQPSSIPGSVLQLVGSSYLLRATAWEAYGSAPLTRVNTLIYATCFSDGSSLSDAALAHVKLIQHLAVFKGYKEAFSALKIAEEKFLSVSKSRILLLKLQLLHERSLHRGHLKLAQKVCDELGVMASSVTGVDMDLKTEASLRHARTLLAANQFSEAAAVAHSLFCMCYKFNLQVENASVLLLLAEIHKKSGNAVLGIPYALASLSFCQLLNLDLLKASATLTLAELWLSFGPNHAKMASNLIQQALPLILGHGGLELRARAFIAEAKCLLSDPSFSVSQNPEAVLDPLRQASEELQVLEDHELAAEAFYLIAIVFDKLGRLAEREEAAALFKEYVLALENENRQDEVDPLLSTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anaphase-promoting complex subunit 5 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.probableQ8H1U4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HZ4, chain A
Confidence level:confident
Coverage over the Query: 434-749
View the alignment between query and template
View the model in PyMOL
Template: 2KAT, chain A
Confidence level:probable
Coverage over the Query: 157-201,220-272
View the alignment between query and template
View the model in PyMOL