Citrus Sinensis ID: 004087
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 774 | ||||||
| 255571020 | 889 | conserved hypothetical protein [Ricinus | 0.873 | 0.760 | 0.806 | 0.0 | |
| 449503321 | 942 | PREDICTED: ion channel DMI1-like [Cucumi | 0.945 | 0.777 | 0.715 | 0.0 | |
| 449435486 | 915 | PREDICTED: ion channel DMI1-like [Cucumi | 0.943 | 0.797 | 0.714 | 0.0 | |
| 225448136 | 818 | PREDICTED: ion channel DMI1 [Vitis vinif | 0.808 | 0.765 | 0.821 | 0.0 | |
| 224129674 | 711 | predicted protein [Populus trichocarpa] | 0.710 | 0.773 | 0.9 | 0.0 | |
| 224119998 | 693 | predicted protein [Populus trichocarpa] | 0.691 | 0.772 | 0.925 | 0.0 | |
| 357445307 | 882 | DMI1 protein [Medicago truncatula] gi|62 | 0.908 | 0.797 | 0.673 | 0.0 | |
| 133740540 | 894 | DMI1 protein homologue [Pisum sativum] | 0.934 | 0.808 | 0.684 | 0.0 | |
| 161105393 | 894 | SYM8 [Pisum sativum] | 0.934 | 0.808 | 0.684 | 0.0 | |
| 356541860 | 864 | PREDICTED: ion channel DMI1 [Glycine max | 0.908 | 0.813 | 0.698 | 0.0 |
| >gi|255571020|ref|XP_002526461.1| conserved hypothetical protein [Ricinus communis] gi|223534241|gb|EEF35956.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1107 bits (2864), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 554/687 (80%), Positives = 601/687 (87%), Gaps = 11/687 (1%)
Query: 77 NERDWMYPSFLGPHM---GRRRIKVKPSK----LEFKGNEEKKRIQELGSKKEEKAVASL 129
+ RDW+YPSFLGPH+ G R+ VK + E KG + ++E +K+EK + +
Sbjct: 45 DSRDWVYPSFLGPHVVAAGANRVTVKGRRGKVVEERKGTVSRDSVKE---EKKEKVASQV 101
Query: 130 AVTQSNSVTQTSSVTQLSGRT-RGLKSSLMTYYMLIINCILCVCYAIHLRDRVEKLEEEN 188
VTQS S+TQ+++ + RT RGL +Y LI CIL V +IHLR +V KLEEEN
Sbjct: 102 LVTQSGSLTQSTATGVIRSRTSRGLFKHSFVFYFLIFTCILSVSCSIHLRIKVRKLEEEN 161
Query: 189 SSLRRFCSYKSIAGNNGIDVLHTDNNSDSNFGNADGRTVALYSVIVTLLMPFVLYKYLDY 248
+LR CS +S GNN I+VL +++S NF N D R VALYSVI TL+MPF+ YKYLDY
Sbjct: 162 INLRTACSNQSGVGNNSIEVLQLEDDSSFNFQNGDSRAVALYSVIFTLIMPFLFYKYLDY 221
Query: 249 LPQIKNFSKRTKKNKEEVPLKKRVAYSVDVCFSVYPYAKLLALLFATIFLIIFGGLALYA 308
LP+IK SKRT+ NKEEVPLKKR+AY VDV FSVYPYAKLLALLFATIFLI FGGLALYA
Sbjct: 222 LPEIKTLSKRTRNNKEEVPLKKRIAYMVDVFFSVYPYAKLLALLFATIFLIGFGGLALYA 281
Query: 309 VSDSSFAEALWLSWTFVADSGNHADRVGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK 368
VSD SFAEALWLSWTFVADSGNHADR+GTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK
Sbjct: 282 VSDGSFAEALWLSWTFVADSGNHADRIGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK 341
Query: 369 VDSLRKGKSEVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDI 428
VDSLRKGKSEVIEK HILILGWSDKLGSLLKQLA+ANKSIGGGV+VVLAERDKEEMEMDI
Sbjct: 342 VDSLRKGKSEVIEKKHILILGWSDKLGSLLKQLAIANKSIGGGVVVVLAERDKEEMEMDI 401
Query: 429 AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLT 488
AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDA ALRVVLSLT
Sbjct: 402 AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDAHALRVVLSLT 461
Query: 489 GVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI 548
GVKEGL+GHVVVEMSD+DNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI
Sbjct: 462 GVKEGLKGHVVVEMSDVDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI 521
Query: 549 LGFENAEFYIKRWPQLDDLRFEEVVISFPDAIPCGIKVAAEGGKIILNPDDNYVLKEGDE 608
LGFENAEFYIKRWPQLD LRFE+V+ISFPDAIPCG+K+AAEGGKI LNPDD+YVLKEGDE
Sbjct: 522 LGFENAEFYIKRWPQLDGLRFEDVLISFPDAIPCGVKLAAEGGKINLNPDDSYVLKEGDE 581
Query: 609 VLVIAEDDDTYAPGPLPEVCKRSFLKIPDPPKYPEKILFCGWRRDIDDMIMVLEAFLAPG 668
+LVIAEDDDTYAPGPLP+V + S K+ DPPKYPEKILFCGWRRDIDDMIMVLE LAPG
Sbjct: 582 ILVIAEDDDTYAPGPLPKVRRGSCPKLIDPPKYPEKILFCGWRRDIDDMIMVLEECLAPG 641
Query: 669 SELWMLNEVPEKEREKKLTDGGLDISGLMNIKLVHREGNAVIRRHLESLPLETFDSILIL 728
SELWM NEVPEKEREKKLTDGGLD SGL NIKLVHREGNAVIRRHL+SLPLETFDSILIL
Sbjct: 642 SELWMFNEVPEKEREKKLTDGGLDTSGLENIKLVHREGNAVIRRHLDSLPLETFDSILIL 701
Query: 729 ADESLEDSIVHSDSRSLATLLLIRDIQ 755
ADESLEDS+VHSDSRSLATLLLIRDIQ
Sbjct: 702 ADESLEDSVVHSDSRSLATLLLIRDIQ 728
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449503321|ref|XP_004161944.1| PREDICTED: ion channel DMI1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449435486|ref|XP_004135526.1| PREDICTED: ion channel DMI1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225448136|ref|XP_002263318.1| PREDICTED: ion channel DMI1 [Vitis vinifera] gi|297739532|emb|CBI29714.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224129674|ref|XP_002328774.1| predicted protein [Populus trichocarpa] gi|222839072|gb|EEE77423.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224119998|ref|XP_002331112.1| predicted protein [Populus trichocarpa] gi|222872840|gb|EEF09971.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357445307|ref|XP_003592931.1| DMI1 protein [Medicago truncatula] gi|62286545|sp|Q6RHR6.1|DMI1_MEDTR RecName: Full=Ion channel DMI1; AltName: Full=Does not make infections protein 1 gi|44953222|gb|AAS49490.1| DMI1 protein [Medicago truncatula] gi|92870250|gb|ABE79577.1| Ion channel DMI-1 , putative [Medicago truncatula] gi|355481979|gb|AES63182.1| DMI1 protein [Medicago truncatula] gi|357394659|gb|AET75788.1| DMI1 [Cloning vector pHUGE-MtNFS] gi|357394672|gb|AET75800.1| DMI1 [Cloning vector pHUGE-LjMtNFS] | Back alignment and taxonomy information |
|---|
| >gi|133740540|emb|CAJ00334.2| DMI1 protein homologue [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|161105393|gb|ABX57723.1| SYM8 [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|356541860|ref|XP_003539390.1| PREDICTED: ion channel DMI1 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 774 | ||||||
| UNIPROTKB|Q4VY51 | 894 | SYM8 "Probable ion channel SYM | 0.913 | 0.790 | 0.669 | 1.3e-248 | |
| TAIR|locus:2158799 | 824 | AT5G49960 [Arabidopsis thalian | 0.751 | 0.706 | 0.746 | 1.4e-229 | |
| TAIR|locus:505006671 | 817 | AT5G43745 [Arabidopsis thalian | 0.385 | 0.364 | 0.253 | 9.8e-28 | |
| TAIR|locus:2151276 | 813 | AT5G02940 [Arabidopsis thalian | 0.385 | 0.366 | 0.230 | 1.1e-27 | |
| UNIPROTKB|O27564 | 336 | mthK "Calcium-gated potassium | 0.208 | 0.479 | 0.237 | 9.9e-10 |
| UNIPROTKB|Q4VY51 SYM8 "Probable ion channel SYM8" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
Score = 2365 (837.6 bits), Expect = 1.3e-248, Sum P(2) = 1.3e-248
Identities = 487/727 (66%), Positives = 553/727 (76%)
Query: 39 PAVRRT----DKP-FDLRVSIXXXXXXXXXXXXXXXXXXXNGFNERDWMYPSFLG-PHMG 92
P ++RT +P +LRVSI F ++ YPSFLG
Sbjct: 17 PPLKRTKTLAQQPSLNLRVSIAAADNGIGNSSSSSTKTD---FEQQQRNYPSFLGIGSTS 73
Query: 93 RRRIKVKPSKLEFKGNEEKKRIQELGSKKEEKAVASLAXXXXXXXXXXXXXXXLSGRTRG 152
R+R P K K + +K + S + +
Sbjct: 74 RKRRPPPPPKPSNITPNVKPPASDFQTKPHSEPKTSPSSSSPPSLPIAITKQ--QQQQHS 131
Query: 153 LKSSLMTYYMLIINCILCVCYAIHLRDRVEKLEEENSSLRRFCSYKSIAGNNGIDVLHTD 212
+ S + +Y+ +I C++ V Y+ L+ ++ KL++ L C NG L D
Sbjct: 132 ISSPI--FYLFVITCVIFVPYSAFLQYKLAKLKDMKLQL---CCQIDFCSGNGKTSLQKD 186
Query: 213 NNSDSNFG----NADGRTVALYSVIVTLLMPFVLYKYLDYLPQIKNFSKRTKKNKEEVPL 268
D +F NAD RT++LY V+ TL++PF+LYKY+DYLPQ+ NFS+RT NKE+VPL
Sbjct: 187 VVDDGSFSYYILNADSRTISLYIVLFTLVLPFILYKYIDYLPQMINFSRRTNSNKEDVPL 246
Query: 269 KKRVAYSVDVCFSVYPYAKXXXXXXXXXXXXXXXXXALYAVSDSSFAEALWLSWTFVADS 328
KKRVAY VDV FS+YPYAK ALYAV+ S AEALW SWT+VAD+
Sbjct: 247 KKRVAYMVDVFFSIYPYAKLLALLFATLFLIAFGGLALYAVTGGSMAEALWHSWTYVADA 306
Query: 329 GNHADRVGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIEKNHILIL 388
GNHA+ G G RIVSVSIS+GGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIE+NH+LIL
Sbjct: 307 GNHAETEGMGQRIVSVSISAGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIERNHVLIL 366
Query: 389 GWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPL 448
GWSDKLGSLLKQLA+ANKS+GGGVIVVLAE++KEEMEMDIAKLEFDFMGTSVICRSGSPL
Sbjct: 367 GWSDKLGSLLKQLAIANKSVGGGVIVVLAEKEKEEMEMDIAKLEFDFMGTSVICRSGSPL 426
Query: 449 ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNE 508
ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKE LRGHVVVEMSDLDNE
Sbjct: 427 ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEALRGHVVVEMSDLDNE 486
Query: 509 PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPQLDDLR 568
PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWP+LD L
Sbjct: 487 PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPELDGLL 546
Query: 569 FEEVVISFPDAIPCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIAEDDDTYAPGPLPEVC 628
F++++ISFPDAIPCG+KV+A+GGKI++NPDDNYVL++GDEVLVIAEDDDTYAPGPLPEV
Sbjct: 547 FKDILISFPDAIPCGVKVSADGGKIVINPDDNYVLRDGDEVLVIAEDDDTYAPGPLPEVR 606
Query: 629 KRSFLKIPDPPKYPEKILFCGWRRDIDDMIMVLEAFLAPGSELWMLNEVPEKEREKKLTD 688
K F +I DPPKYPEKILFCGWRRDIDDMIMVLEAFLAPGSELWM NEVPEK+RE+KL
Sbjct: 607 KGYFPRIRDPPKYPEKILFCGWRRDIDDMIMVLEAFLAPGSELWMFNEVPEKQRERKLAA 666
Query: 689 GGLDISGLMNIKLVHREGNAVIRRHLESLPLETFDSILILADESLEDSIVHSDSRSLATL 748
G LD+ GL NIKLVHREGNAVIRRHLESLPLETFDSILILADES+EDS+ HSDSRSLATL
Sbjct: 667 GELDVFGLENIKLVHREGNAVIRRHLESLPLETFDSILILADESVEDSVAHSDSRSLATL 726
Query: 749 LLIRDIQ 755
LLIRDIQ
Sbjct: 727 LLIRDIQ 733
|
|
| TAIR|locus:2158799 AT5G49960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006671 AT5G43745 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151276 AT5G02940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O27564 mthK "Calcium-gated potassium channel MthK" [Methanothermobacter thermautotrophicus str. Delta H (taxid:187420)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 774 | |||
| pfam06241 | 208 | pfam06241, DUF1012, Protein of unknown function (D | 8e-13 |
| >gnl|CDD|114933 pfam06241, DUF1012, Protein of unknown function (DUF1012) | Back alignment and domain information |
|---|
Score = 67.8 bits (165), Expect = 8e-13
Identities = 43/153 (28%), Positives = 81/153 (52%), Gaps = 5/153 (3%)
Query: 461 ARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIE 520
ARAII+L + + + D A VL+L +++ +VE+S + L+K + G +E
Sbjct: 1 ARAIIILPTKGDRYEVDTDAFLSVLALEPIQKMESIPTIVEVSSPNMYDLLKSISGLKVE 60
Query: 521 TVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPQLDDLRFEEVVISFPDAI 580
V + +L +QC+ Q L +I+ +L + F + +P L +++ ++ + F + +
Sbjct: 61 PV--ENSTSKLFVQCSRQKDLIKIYRHLLNYSKNVFNLCSFPNLTGMKYRQLRLGFQEVV 118
Query: 581 PCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIA 613
CGI GK+ +P+D+ L E D++L IA
Sbjct: 119 VCGI---LRDGKVNFHPNDDEELMETDKLLFIA 148
|
Family of uncharacterized proteins found in both eukaryotes and bacteria. Length = 208 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 774 | |||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.97 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.97 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 99.96 | |
| PF06241 | 206 | DUF1012: Protein of unknown function (DUF1012); In | 99.94 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 99.9 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.86 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 99.84 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 99.7 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 99.62 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 99.62 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 99.58 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.11 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 98.92 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 98.91 | |
| COG1226 | 212 | Kch Kef-type K+ transport systems, predicted NAD-b | 98.77 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 98.66 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 98.65 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 98.6 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 98.59 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 98.55 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 98.52 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.45 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 98.41 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 98.39 | |
| COG0490 | 162 | Putative regulatory, ligand-binding protein relate | 98.25 | |
| COG3400 | 471 | Uncharacterized protein conserved in bacteria [Fun | 97.95 | |
| PF02080 | 71 | TrkA_C: TrkA-C domain; InterPro: IPR006037 The reg | 97.94 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 97.91 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 97.74 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.7 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 97.58 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 97.56 | |
| PF03493 | 101 | BK_channel_a: Calcium-activated BK potassium chann | 97.31 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.19 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 97.19 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 97.17 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 97.06 | |
| COG3273 | 204 | Uncharacterized conserved protein [Function unknow | 96.88 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 96.6 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.6 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 96.21 | |
| COG1226 | 212 | Kch Kef-type K+ transport systems, predicted NAD-b | 96.2 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 95.95 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 95.52 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 95.48 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 95.47 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 94.87 | |
| PRK05326 | 562 | potassium/proton antiporter; Reviewed | 94.46 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 93.81 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 93.41 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 93.18 | |
| PRK04972 | 558 | putative transporter; Provisional | 92.96 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 92.63 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 92.53 | |
| PRK03818 | 552 | putative transporter; Validated | 92.52 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 92.52 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 92.51 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 92.32 | |
| PLN02366 | 308 | spermidine synthase | 92.18 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 92.18 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 91.74 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 91.6 | |
| PRK03818 | 552 | putative transporter; Validated | 91.56 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 91.46 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 91.16 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 90.92 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 90.58 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 90.2 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 89.83 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 89.82 | |
| COG0168 | 499 | TrkG Trk-type K+ transport systems, membrane compo | 89.78 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 89.76 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 89.69 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 89.61 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 89.48 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 89.08 | |
| PRK04972 | 558 | putative transporter; Provisional | 88.97 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 88.8 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 88.67 | |
| COG3263 | 574 | NhaP-type Na+/H+ and K+/H+ antiporters with a uniq | 88.3 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 88.04 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 87.93 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 87.72 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 87.67 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 87.62 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 87.48 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 87.18 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 86.47 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 86.3 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 86.12 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 86.08 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 85.74 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 85.7 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 85.55 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 85.38 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 85.11 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 85.09 | |
| PLN02823 | 336 | spermine synthase | 85.07 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 85.07 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 84.72 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 84.52 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.47 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 84.24 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 84.22 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 83.98 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 83.51 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 83.37 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 83.1 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 83.07 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 82.99 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 82.86 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 82.76 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 82.73 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 82.69 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 82.49 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 82.37 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 82.27 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 82.18 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 81.96 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 81.95 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 81.94 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 81.9 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 81.86 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 81.73 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 81.73 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 81.23 | |
| TIGR00934 | 800 | 2a38euk potassium uptake protein, Trk family. The | 81.1 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 80.92 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 80.88 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 80.83 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 80.71 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 80.56 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 80.48 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 80.37 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 80.27 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 80.24 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 80.09 |
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.2e-30 Score=285.78 Aligned_cols=231 Identities=20% Similarity=0.239 Sum_probs=188.6
Q ss_pred HHHHHHHHHHhhhhhhccC------CCHHHHHHHHHHHhhccCCCCC-CCCccCceeeehhhHhHHHHHHHHHHHHHH-H
Q 004087 293 FATIFLIIFGGLALYAVSD------SSFAEALWLSWTFVADSGNHAD-RVGTGPRIVSVSISSGGMLIFAMMLGLVSD-A 364 (774)
Q Consensus 293 ~~~l~lil~g~~~~~~ie~------~s~~dAly~~~~TltTvGygd~-~~t~~gRi~~v~lil~Gl~ifa~lig~i~~-~ 364 (774)
+.+..+++.|+++++++++ .++.|||||+++|+||+||||. |.+..||+|+++++++|+++|++.++.++. .
T Consensus 142 ~~~~~l~~~~~~g~~~~~~~f~~~~~s~~dA~y~svvt~tTvGyGdi~p~t~~grl~~i~~ii~Gi~vf~~~is~i~~p~ 221 (393)
T PRK10537 142 ISITSLLFYSTFGALYLGDGFSPPIESLSTAFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFATSISAIFGPV 221 (393)
T ss_pred HHHHHHHHHHHHHHHHHccccCcCCCCHHHHHHhhheeeecccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4455666777777776664 6999999999999999999998 788899999999999999999998887765 5
Q ss_pred HHHHHHhhhcCcc-cccccCeEEEEcccchHHHHHHHHHHhcccCCCCceEEEEcCChHHHHHHHHhhhcccCCccEEEE
Q 004087 365 ISEKVDSLRKGKS-EVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICR 443 (774)
Q Consensus 365 i~~~l~~lr~G~~-~v~~k~HIII~G~g~~~~~li~eL~~~~~~~~~~~iVVLid~d~e~le~~l~~~~~~~~~~~V~~I 443 (774)
+.+++++..+++. ....+||+||||||+.+..++++|.+. +.+|+++|+|+. ++.. ..++.++
T Consensus 222 i~~~l~~~~~~~~~~~~~k~HvII~G~g~lg~~v~~~L~~~------g~~vvVId~d~~--~~~~--------~~g~~vI 285 (393)
T PRK10537 222 IRGNLKRLVKGRISHMHRKDHFIICGHSPLAINTYLGLRQR------GQAVTVIVPLGL--EHRL--------PDDADLI 285 (393)
T ss_pred HHHHHHHHHHhhhhhcccCCeEEEECCChHHHHHHHHHHHC------CCCEEEEECchh--hhhc--------cCCCcEE
Confidence 5555555433332 234589999999999999999999752 367888887642 2221 2346789
Q ss_pred EeCCCCHHHHhccCcccccEEEEecCCCCCCcchHHHHHHHHHHhhhcCCCCceEEEEecCCCCHHHHHHcCCCeeEEec
Q 004087 444 SGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETVV 523 (774)
Q Consensus 444 ~Gd~t~~e~L~rAgI~~A~aVIiltdd~~~~~sDa~NI~~~Laar~l~p~~~~~IIArv~d~e~~~~l~~~Gad~VevV~ 523 (774)
.||++++++|++||+++|+++|+++++ |++|+.+++++|+++| +.+|||++.++++.++++.+|+|. +|+
T Consensus 286 ~GD~td~e~L~~AgI~~A~aVI~~t~d------D~~Nl~ivL~ar~l~p--~~kIIa~v~~~~~~~~L~~~GaD~--VIs 355 (393)
T PRK10537 286 PGDSSDSAVLKKAGAARARAILALRDN------DADNAFVVLAAKEMSS--DVKTVAAVNDSKNLEKIKRVHPDM--IFS 355 (393)
T ss_pred EeCCCCHHHHHhcCcccCCEEEEcCCC------hHHHHHHHHHHHHhCC--CCcEEEEECCHHHHHHHHhcCCCE--EEC
Confidence 999999999999999999999999976 9999999999999998 467999999999999999999998 589
Q ss_pred cHHHHHHHHHHHHcCCcHH-HHHHHHh
Q 004087 524 AHDVIGRLMIQCALQPGLA-QIWEDIL 549 (774)
Q Consensus 524 ~~el~a~lLaq~~~~Pg~~-~Vl~~Ll 549 (774)
|.++.+++|++.+..+.+. +.+.+++
T Consensus 356 p~~l~g~~la~~l~g~~I~~~~i~~~~ 382 (393)
T PRK10537 356 PQLLGSELLARTLNGEEIDNDMITSML 382 (393)
T ss_pred HHHHHHHHHHHHhcCCCCCHHHHHHHH
Confidence 9999999999999876553 4455554
|
|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06241 DUF1012: Protein of unknown function (DUF1012); InterPro: IPR010420 This entry represents the CASTOR/POLLUX/SYM8 family of ion channels, which are found in plants | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0490 Putative regulatory, ligand-binding protein related to C-terminal domains of K+ channels [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3400 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02080 TrkA_C: TrkA-C domain; InterPro: IPR006037 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03493 BK_channel_a: Calcium-activated BK potassium channel alpha subunit; InterPro: IPR003929 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3273 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05326 potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >COG0168 TrkG Trk-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00934 2a38euk potassium uptake protein, Trk family | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 774 | ||||
| 3rbz_A | 340 | Mthk Channel, Ca2+-Bound Length = 340 | 6e-06 | ||
| 1lnq_A | 336 | Crystal Structure Of Mthk At 3.3 A Length = 336 | 1e-05 | ||
| 3rbx_A | 234 | Mthk Rck Domain D184n Mutant, Ca2+-Bound Length = 2 | 1e-05 | ||
| 2fy8_A | 230 | Crystal Structure Of Mthk Rck Domain In Its Ligand- | 1e-05 | ||
| 4ei2_A | 242 | Crystal Structures Of Mthk Rck Gating Ring Bound To | 1e-05 | ||
| 2aef_A | 234 | Crystal Structures Of The Mthk Rck Domain In Ca2+ B | 1e-05 | ||
| 2ogu_A | 233 | Crystal Structure Of The Isolated Mthk Rck Domain L | 1e-05 | ||
| 3kxd_A | 224 | Crystal Structure Of The Mthk Rck In Complex With C | 3e-05 |
| >pdb|3RBZ|A Chain A, Mthk Channel, Ca2+-Bound Length = 340 | Back alignment and structure |
|
| >pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 | Back alignment and structure |
| >pdb|3RBX|A Chain A, Mthk Rck Domain D184n Mutant, Ca2+-Bound Length = 234 | Back alignment and structure |
| >pdb|2FY8|A Chain A, Crystal Structure Of Mthk Rck Domain In Its Ligand-Free Gating-Ring Form Length = 230 | Back alignment and structure |
| >pdb|4EI2|A Chain A, Crystal Structures Of Mthk Rck Gating Ring Bound To Barium Length = 242 | Back alignment and structure |
| >pdb|2AEF|A Chain A, Crystal Structures Of The Mthk Rck Domain In Ca2+ Bound Form Length = 234 | Back alignment and structure |
| >pdb|2OGU|A Chain A, Crystal Structure Of The Isolated Mthk Rck Domain Length = 233 | Back alignment and structure |
| >pdb|3KXD|A Chain A, Crystal Structure Of The Mthk Rck In Complex With Cadmium Length = 224 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 774 | |||
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 2e-47 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 6e-45 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 4e-38 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 4e-04 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 1e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 1e-07 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 5e-05 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 4e-04 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 7e-04 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 7e-04 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 9e-04 |
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
Score = 170 bits (433), Expect = 2e-47
Identities = 68/341 (19%), Positives = 145/341 (42%), Gaps = 41/341 (12%)
Query: 286 AKLLALLFATIFLIIFGGLALYAVSDSSFAEALWLSWTFVADS----GNHADRVGTGPRI 341
+L + +II+G + + S+ +L+ WTFV + G+++ G
Sbjct: 18 VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLY--WTFVTIATVGYGDYSPSTPLG-MY 74
Query: 342 VSVSISSGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIEKNHILILGWSDKLGSLLKQL 401
+V++ G+ FA+ + + + + + G +V + H++I GWS+ L++L
Sbjct: 75 FTVTLIVLGIGTFAVAVERLLEFLINREQMKLMGLIDVAKSRHVVICGWSESTLECLREL 134
Query: 402 AVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPLILADLKKVSVSKA 461
G V V+ + + + + G + + G P ++DL+K +V A
Sbjct: 135 R------GSEVFVLAEDENVRK--------KVLRSGANFV--HGDPTRVSDLEKANVRGA 178
Query: 462 RAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIET 521
RA+IV D+ + +L + + E + ++ E +N +++ G + +
Sbjct: 179 RAVIVDLES------DSETIHCILGIRKIDESV--RIIAEAERYENIEQLRMAGAD--QV 228
Query: 522 VVAHDVIGRLMIQCALQPGLAQIWEDILGFEN----AEFYIKRWPQLDDLRFEEVVI-SF 576
+ + GRLM + A +D+L E+ E I +L+ + + I
Sbjct: 229 ISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIHDV 288
Query: 577 PDAIPCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIAEDDD 617
I G+ G ++I++P +Y + GD +L I + ++
Sbjct: 289 TGVIIIGVG---RGDELIIDPPRDYSFRAGDIILGIGKPEE 326
|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Length = 798 | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726 | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 774 | |||
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 100.0 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 100.0 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 100.0 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 100.0 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 100.0 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 99.97 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 99.92 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 99.89 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.86 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 99.82 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 99.68 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 99.61 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 99.53 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 99.49 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.38 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.34 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.34 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.34 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 99.33 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.32 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.32 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.32 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.32 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.31 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 99.28 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.27 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.27 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 99.27 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.24 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.24 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.19 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 99.18 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 99.11 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 99.1 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.08 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.06 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.02 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.01 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 98.92 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 98.83 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 98.76 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.72 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 98.66 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 98.66 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.59 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 98.53 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 98.49 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 98.45 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 98.43 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 98.42 | |
| 1vct_A | 205 | Hypothetical protein PH0236; helix rich, structura | 98.3 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 98.03 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.95 | |
| 3jxo_A | 86 | TRKA-N domain protein; TRKA K+ channel component, | 97.9 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 97.79 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.76 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.6 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.5 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.37 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 95.12 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 94.69 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 94.5 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 94.2 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 93.71 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.39 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 93.36 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.31 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 92.87 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 92.27 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 91.97 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 91.95 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 91.95 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 91.72 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 91.59 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 91.49 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 91.4 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 91.31 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 91.29 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 90.96 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 90.75 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 90.67 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 90.66 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 90.56 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 90.54 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 90.39 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 89.99 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 89.92 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 89.84 | |
| 3on5_A | 362 | BH1974 protein; structural genomics, joint center | 89.78 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 89.73 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 89.66 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 89.61 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 89.44 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 89.37 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 89.3 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 89.17 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 89.15 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 88.9 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 88.86 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 88.77 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 88.65 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 88.18 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.99 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 87.98 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 87.86 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 87.78 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 87.64 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 87.48 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 87.42 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 87.38 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 87.2 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 87.07 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 87.05 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 87.04 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 86.97 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 86.79 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 86.79 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 86.76 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 86.62 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 86.57 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 86.49 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 86.42 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 86.25 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 85.82 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 85.69 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 85.68 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 85.64 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 85.4 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 85.19 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 84.94 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 84.89 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 84.71 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 84.6 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 84.48 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 84.43 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 84.41 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 84.24 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 84.01 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 83.61 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 83.59 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 83.54 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 83.46 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 83.43 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 83.41 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 83.36 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 83.21 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 83.11 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 83.1 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 83.07 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 83.03 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 83.01 | |
| 3pjz_A | 494 | Potassium uptake protein TRKH; structural genomics | 82.94 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 82.94 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 82.71 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 82.61 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 82.58 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 82.39 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 82.32 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 82.29 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 82.24 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 82.16 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 82.11 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 81.96 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 81.91 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 81.86 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 81.84 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 81.79 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 81.78 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 81.75 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 81.48 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 81.48 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 81.46 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 81.32 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 81.15 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 81.15 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 81.13 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 81.11 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 81.11 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 81.1 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 80.89 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 80.83 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 80.81 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 80.61 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 80.51 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 80.45 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 80.44 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 80.41 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 80.4 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 80.37 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 80.29 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 80.29 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 80.28 |
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-51 Score=472.59 Aligned_cols=406 Identities=16% Similarity=0.179 Sum_probs=266.7
Q ss_pred chhHHHHHHHHHHHHHHHHHhhhhhh----ccC--CCHHHHHHHHHHHhhccCCCCC-CCCccCceeeehhhHhHHHHHH
Q 004087 283 YPYAKLLALLFATIFLIIFGGLALYA----VSD--SSFAEALWLSWTFVADSGNHAD-RVGTGPRIVSVSISSGGMLIFA 355 (774)
Q Consensus 283 ~~~~~~l~Ll~~~l~lil~g~~~~~~----ie~--~s~~dAly~~~~TltTvGygd~-~~t~~gRi~~v~lil~Gl~ifa 355 (774)
..+..++.+++++++++++++++|++ +|+ ++|+|||||+++|+||+||||. |.+..||+|+++++++|+++++
T Consensus 15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~y~~~~t~tTvGygd~~p~~~~~~~~~~~~~~~g~~~~~ 94 (565)
T 4gx0_A 15 QNLKVLLLYCAFLLVMLLAYASIFRYLMWHLEGRAYSFMAGIYWTITVMTTLGFGDITFESDAGYLFASIVTVSGVIFLD 94 (565)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHHHHHHHHHHHH
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCchhhhhheeeeeeeeecCCCcCCCCccHHHHHHHHHHHHHHHHH
Confidence 33444555556666666677766655 566 8999999999999999999998 6788999999999999999999
Q ss_pred HHHHH-HHHHHHHH-HHh----hhcCcccccccCeEEEEcccchHHHHHHHHHHhcccCCCCceEEEEcCChHHHHHHHH
Q 004087 356 MMLGL-VSDAISEK-VDS----LRKGKSEVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIA 429 (774)
Q Consensus 356 ~lig~-i~~~i~~~-l~~----lr~G~~~v~~k~HIII~G~g~~~~~li~eL~~~~~~~~~~~iVVLid~d~e~le~~l~ 429 (774)
+.++. +++.+... +++ .+.++.....++|+||||||+.+..++++|.+. ++.|+++|.|++.++...+
T Consensus 95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hviI~G~g~~g~~la~~L~~~------~~~vvvid~~~~~~~~~~~ 168 (565)
T 4gx0_A 95 IILPFGFVSMFLAPWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESR------NHLFVVVTDNYDQALHLEE 168 (565)
T ss_dssp THHHHHHHHHHHHHHHHHHTSCCCBCCCCTTCCSCEEEESCCHHHHHHHHHTTTT------TCCEEEEESCHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHhhcccccccccCCeEEEECCChHHHHHHHHHHHC------CCCEEEEECCHHHHHHHHH
Confidence 98887 55554443 222 222333346789999999999999999999753 4789999999988876543
Q ss_pred hhhcccCCccEEEEEeCCCCHHHHhccCcccccEEEEecCCCCCCcchHHHHHHHHHHhhhcCCCCceEEEEecCCCCHH
Q 004087 430 KLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEP 509 (774)
Q Consensus 430 ~~~~~~~~~~V~~I~Gd~t~~e~L~rAgI~~A~aVIiltdd~~~~~sDa~NI~~~Laar~l~p~~~~~IIArv~d~e~~~ 509 (774)
. .++.++.||++++++|++||+++|+++|+ +.+ |+.|+.+|+++|+++ . .+|||++.++++.+
T Consensus 169 ~-------~~~~~i~Gd~~~~~~L~~a~i~~a~~vi~-t~~------D~~n~~~~~~ar~~~-~--~~iiar~~~~~~~~ 231 (565)
T 4gx0_A 169 Q-------EGFKVVYGSPTDAHVLAGLRVAAARSIIA-NLS------DPDNANLCLTVRSLC-Q--TPIIAVVKEPVHGE 231 (565)
T ss_dssp S-------CSSEEEESCTTCHHHHHHTTGGGCSEEEE-CSC------HHHHHHHHHHHHTTC-C--CCEEEECSSGGGHH
T ss_pred h-------cCCeEEEeCCCCHHHHHhcCcccCCEEEE-eCC------cHHHHHHHHHHHHhc-C--ceEEEEECCHHHHH
Confidence 1 26789999999999999999999999998 654 899999999999997 4 57999999999999
Q ss_pred HHHHcCCCeeEEeccHHHHHHHHHHHHcCCcHH-HHHHHHhccCCceEEeccCCccCCCcHHHHhhh-CCCeEEEEEEEe
Q 004087 510 LVKLVGGELIETVVAHDVIGRLMIQCALQPGLA-QIWEDILGFENAEFYIKRWPQLDDLRFEEVVIS-FPDAIPCGIKVA 587 (774)
Q Consensus 510 ~l~~~Gad~VevV~~~el~a~lLaq~~~~Pg~~-~Vl~~Ll~~~g~ei~i~~~p~lvGktf~el~~~-~~~~iVIGI~r~ 587 (774)
.++.+|+|. +|++++..++.|++.+..|+.. +++..--...-.|+.+. .++++|++++|+..+ ..++.++||+|
T Consensus 232 ~l~~~Gad~--vi~p~~~~~~~la~~~~~p~~~~~~~~~~~~~~l~e~~v~-~s~l~G~~l~el~~~~~~~~~vi~i~r- 307 (565)
T 4gx0_A 232 LLRLAGANQ--VVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELPVH-GTPFAGKTIGESGIRQRTGLSIIGVWE- 307 (565)
T ss_dssp HHHHHTCSE--EECHHHHHHHHHHHHHHC---------------------------------------------------
T ss_pred HHHHcCCCE--EEChHHHHHHHHHHHhcccccccchhcccCCceEEEEEEC-CCccCCCCHHHcCcchhcCCEEEEEEE-
Confidence 999999998 5899999999999999999985 43321111122456666 788999999998754 35799999997
Q ss_pred ecCCeEEeCCCCCceecCCCEEEEEEeCCCCCCCCCCccccccccccCCCCCCCCceEEEEcccccHHHHHHHHHHhcCC
Q 004087 588 AEGGKIILNPDDNYVLKEGDEVLVIAEDDDTYAPGPLPEVCKRSFLKIPDPPKYPEKILFCGWRRDIDDMIMVLEAFLAP 667 (774)
Q Consensus 588 ~~~g~~~lnP~~d~vL~~GD~LiVIa~~d~~~~~~~~p~v~~~~~~~~~~~~~~~~rILI~Gwg~~g~~l~~~L~~~l~~ 667 (774)
+|+.. +|+++++|++||.|+++|+.+++.++... .+...+. ++++|||||+.|..+++.|.+.
T Consensus 308 --~g~~~-~p~~~~~l~~GD~L~v~g~~~~l~~~~~~----------~~~~~~~-~~viIiG~G~~G~~la~~L~~~--- 370 (565)
T 4gx0_A 308 --RGSLT-TPQRETVLTEQSLLVLAGTKSQLAALEYL----------IGEAPED-ELIFIIGHGRIGCAAAAFLDRK--- 370 (565)
T ss_dssp ----------------------------------------------------CC-CCEEEECCSHHHHHHHHHHHHT---
T ss_pred --CCEEe-CCCCCcEeCCCCEEEEEeCHHHHHHHHHH----------hcCCCCC-CCEEEECCCHHHHHHHHHHHHC---
Confidence 46665 99999999999999999999988776432 1112223 8999999999999999999874
Q ss_pred CCeEEEEecCChhHHHHHhhcCCCCcCCCCCceEEEEecCcccHhhhhcCCCCCccEEEEeeCCCCcCCcCCCcHHHHHH
Q 004087 668 GSELWMLNEVPEKEREKKLTDGGLDISGLMNIKLVHREGNAVIRRHLESLPLETFDSILILADESLEDSIVHSDSRSLAT 747 (774)
Q Consensus 668 Gs~v~II~~~p~~er~~~l~~~g~~~~~l~~i~V~~i~GD~td~~~L~~~~I~~aD~vIiLtdd~~~~~~~~~Ds~~L~t 747 (774)
|.++++|+.++ ++++. +. .+++||++|++.|+++|+++||++|+++++ |..++++
T Consensus 371 g~~v~vid~d~--~~~~~----------~~----~~i~gD~t~~~~L~~agi~~ad~vi~~~~~---------d~~ni~~ 425 (565)
T 4gx0_A 371 PVPFILIDRQE--SPVCN----------DH----VVVYGDATVGQTLRQAGIDRASGIIVTTND---------DSTNIFL 425 (565)
T ss_dssp TCCEEEEESSC--CSSCC----------SS----CEEESCSSSSTHHHHHTTTSCSEEEECCSC---------HHHHHHH
T ss_pred CCCEEEEECCh--HHHhh----------cC----CEEEeCCCCHHHHHhcCccccCEEEEECCC---------chHHHHH
Confidence 99999999875 44332 22 368999999999999999999999999874 6799999
Q ss_pred HHHHHHHhhh
Q 004087 748 LLLIRDIQRY 757 (774)
Q Consensus 748 lLl~r~i~~~ 757 (774)
.+++|++..+
T Consensus 426 ~~~ak~l~~~ 435 (565)
T 4gx0_A 426 TLACRHLHSH 435 (565)
T ss_dssp HHHHHHHCSS
T ss_pred HHHHHHHCCC
Confidence 9999999875
|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/P initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3jxo_A TRKA-N domain protein; TRKA K+ channel component, structural genomics, PSI-2-2, Pro structure initiative, joint center for structural genomics; 1.55A {Thermotoga SP} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3pjz_A Potassium uptake protein TRKH; structural genomics, PSI-2, protein structure initiative, NE consortium on membrane protein structure; 3.51A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 774 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 1e-06 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 7e-06 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 1e-04 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 1e-04 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 44.7 bits (106), Expect = 1e-06
Identities = 13/77 (16%), Positives = 37/77 (48%), Gaps = 3/77 (3%)
Query: 291 LLFATIFLIIFGGLALYAVSDSSFAEALWLSWTFVADSGNHADRVGTGP--RIVSVSISS 348
+L + +II+G + + S+ +L+ ++ +A + + D + P +V++
Sbjct: 5 ILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIA-TVGYGDYSPSTPLGMYFTVTLIV 63
Query: 349 GGMLIFAMMLGLVSDAI 365
G+ FA+ + + + +
Sbjct: 64 LGIGTFAVAVERLLEFL 80
|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 774 | |||
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 99.83 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 99.77 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 99.72 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 99.61 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.43 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.14 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 99.13 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 99.1 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 99.06 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.03 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.01 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 98.73 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.27 | |
| d2fy8a2 | 92 | Potassium channel-related protein MthK, C-terminal | 98.22 | |
| d1vcta2 | 94 | Hypothetical protein PH0236, C-terminal domain {Py | 98.07 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.65 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.01 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 95.9 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.89 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 94.76 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 94.23 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.1 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.92 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.43 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 93.05 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 91.86 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 91.41 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 91.37 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 91.24 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 91.2 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 90.53 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 90.52 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.3 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 90.3 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 90.16 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 90.09 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 90.08 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 88.91 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 88.9 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 88.72 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 88.61 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.45 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 88.42 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 88.32 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 87.93 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 87.62 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 87.33 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 87.24 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 86.96 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 86.81 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 86.81 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 86.79 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 86.76 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 86.72 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 86.56 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 86.32 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 86.24 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 86.05 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 85.97 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 85.95 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 85.92 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 85.63 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 85.29 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 85.21 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 85.1 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 85.07 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 84.83 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 84.8 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 84.62 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 84.52 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 84.5 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 84.15 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 84.06 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 84.03 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 83.98 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 83.94 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 83.9 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 83.71 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 83.66 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 83.61 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 83.61 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 83.43 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 83.41 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 83.41 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 83.37 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 83.09 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 83.06 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 83.03 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 82.88 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 82.7 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 82.65 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 82.58 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 82.53 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 82.42 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 82.25 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 82.19 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 82.07 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 81.98 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 81.97 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 81.94 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 81.88 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 81.84 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 81.69 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 81.51 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 81.46 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 81.37 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 81.36 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 81.27 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 81.08 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 80.66 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 80.57 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 80.45 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 80.44 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 80.37 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 80.2 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 80.03 |
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Potassium channel NAD-binding domain domain: Rck domain from putative potassium channel Kch species: Escherichia coli [TaxId: 562]
Probab=99.83 E-value=1.6e-20 Score=179.23 Aligned_cols=143 Identities=21% Similarity=0.234 Sum_probs=124.4
Q ss_pred ccCeEEEEcccchHHHHHHHHHHhcccCCCCceEEEEcCChHHHHHHHHhhhcccCCccEEEEEeCCCCHHHHhccCccc
Q 004087 381 EKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPLILADLKKVSVSK 460 (774)
Q Consensus 381 ~k~HIII~G~g~~~~~li~eL~~~~~~~~~~~iVVLid~d~e~le~~l~~~~~~~~~~~V~~I~Gd~t~~e~L~rAgI~~ 460 (774)
.+|||||||||+.+..++++|.+. +..|+++|.|++......++. ...++.++.||++++++|++||+++
T Consensus 2 ~knHiII~G~g~~g~~l~~~L~~~------~~~v~vId~d~~~~~~~~~~~----~~~~~~vi~Gd~~d~~~L~~a~i~~ 71 (153)
T d1id1a_ 2 RKDHFIVCGHSILAINTILQLNQR------GQNVTVISNLPEDDIKQLEQR----LGDNADVIPGDSNDSSVLKKAGIDR 71 (153)
T ss_dssp CCSCEEEECCSHHHHHHHHHHHHT------TCCEEEEECCCHHHHHHHHHH----HCTTCEEEESCTTSHHHHHHHTTTT
T ss_pred CCCEEEEECCCHHHHHHHHHHHHc------CCCEEEEeccchhHHHHHHHh----hcCCcEEEEccCcchHHHHHhcccc
Confidence 479999999999999999999863 467888888886544444332 2356889999999999999999999
Q ss_pred ccEEEEecCCCCCCcchHHHHHHHHHHhhhcCCCCceEEEEecCCCCHHHHHHcCCCeeEEeccHHHHHHHHHHHHcCCc
Q 004087 461 ARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPG 540 (774)
Q Consensus 461 A~aVIiltdd~~~~~sDa~NI~~~Laar~l~p~~~~~IIArv~d~e~~~~l~~~Gad~VevV~~~el~a~lLaq~~~~Pg 540 (774)
|+++|+++++ |+.|+.+|+.+|+++|. .++||++.++++.+.++.+|+|. +|+|..+.++.|++.+..|+
T Consensus 72 a~~vi~~~~~------d~~n~~~~~~~r~~~~~--~~iia~~~~~~~~~~l~~~Gad~--vi~p~~~~~~~l~~~l~~~~ 141 (153)
T d1id1a_ 72 CRAILALSDN------DADNAFVVLSAKDMSSD--VKTVLAVSDSKNLNKIKMVHPDI--ILSPQLFGSEILARVLNGEE 141 (153)
T ss_dssp CSEEEECSSC------HHHHHHHHHHHHHHTSS--SCEEEECSSGGGHHHHHTTCCSE--EECHHHHHHHHHHHHHTTCC
T ss_pred CCEEEEcccc------HHHHHHHHHHHHHhCCC--CceEEEEcCHHHHHHHHHCCCCE--EECHHHHHHHHHHHHhCcCC
Confidence 9999999977 99999999999999884 57999999999999999999997 48898999999999999998
Q ss_pred HHH
Q 004087 541 LAQ 543 (774)
Q Consensus 541 ~~~ 543 (774)
+..
T Consensus 142 v~~ 144 (153)
T d1id1a_ 142 INN 144 (153)
T ss_dssp CCH
T ss_pred CCH
Confidence 854
|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2fy8a2 d.286.1.1 (A:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vcta2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|