Citrus Sinensis ID: 004094


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770----
MLTFYVLPKQLIKLNLQPDAKGSYVEVLERYVNLGPIVDFCVVDLERQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLRSSTDDPFDTFLVVSFISETRILAMNLEDELEETEIEGFCSQTQTLFCHDAIYNQLVQVTSGSVRLVSSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYLEIGDGILTEVKHAQLEYEISCLDINPIGENPSYSQIAAVGMWTDISVRIFSLPDLNLITKEHLGGEIIPRSVLLCAFEGISYLLCALGDGHLLNFLLNMKTGELTDRKKVSLGTQPITLRTFSSKNTTHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAKEGELTIGTIDDIQKLHIRSIPLGEHPRRICHQEQSRTFAICSLKNQSCAEESEMHFVRLLDDQTFEFISTYPLDTFEYGCSILSCSFSDDSNVYYCVGTAYVLPEENEPTKGRILVFIVEDGKLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLIYKHEEGAIEERARDYNANWMSAVEILDDDIYLGAENNFNLFTVRKNSEGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDSDVGQIPTVIFGTVNGVIGVIASLPHEQYLFLEKLQTNLRKVIKGVGGLNHEQWRSFNNEKKTVDAKNFLDGDLIESFLDLSRTRMDEISKTMNVSVEELCKRVEELTRLH
cEEEEEcccccEEcccccccccccEEEEEEEccccccccEEEEEcccccccEEEEEEcccccccEEEEEEccEEEEEEEEEcccccEEEEEcccccccccCEEEEEcccccEEEEEcccccEEEEEcccccccccEEEEEEccccEEEEEEccEEEEEEcccccEEEECcccccccEEEEEEcccEEEEEEcccEEEEEEEccEEEEEEEEEcccccEEEEcccccccccccccEEEEEEEcccEEEEEEccccccCECccccccccccEEEEEEEEccEEEEEEccccEEEEEEEcccccccccccEEccccccEEEEEEEEccccEEEEEccccEEEEEcccEEEEEcccccccccccccccccccccEEEEEcccEEEEEEcccccEEEEECcccccccEEEEEccccEEEEEEECcccccccccEEEEEEEcccccEEEEEccccccccEEEEEEEECcccccEEEEEEEEEEccccccccCEEEEEEEEEccEEEEEEEEEEcccEEEEcccccEEEEEEccEEEEEEEEEccccccEEcccccccccEEEEEEEEEccEEEEEEccccEEEEEEEccccEEEEEEcccccccccEEEEEcccccEEEcccccEEEEECccccccccccccEEEEEEEEcccccEEEEcccccccccccccccccEEEEEEEcccEEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccCEEECcHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHccc
MLTFYVLPKQLIKLNLQPDAKGSYVEVLERYVNLGPIVDFCVVDLERQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLRSSTDDPFDTFLVVSFISETRILAMNLEDELEETEIEGFCSQTQTLFCHDAIYNQLVQVTSGSVRLVSSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYLEIGDGILTEVKHAQLEYEISCLDINPIGENPSYSQIAAVGMWTDISVRIFSLPDLNLITKEHLGGEIIPRSVLLCAFEGISYLLCALGDGHLLNFLLNMKTGELTDRKKVSLGTQPITLRTFSSKNTTHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAKEGELTIGTIDDIQKLHIRSIPLGEHPRRICHQEQSRTFAICSLKNQSCAEESEMHFVRLLDDQTFEFISTYPLDTFEYGCSILSCSFSDDSNVYYCVGTAYVLPEENEPTKGRILVFIVEDGKLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLIYKHEEGAIEERARDYNANWMSAVEILDDDIYLGAENNFNLFTVRKNSEGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDSDVGQIPTVIFGTVNGVIGVIASLPHEQYLFLEKLQTNLRKVIKGVGGLNHEQWRSFNNEKKTVDAKNFLDGDLIESFLDLSRTRMDEISKTMNVSVEELCKRVEELTRLH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTFYVLPKQLIKLNLQPDAKGSYVEVLERYVNLGPIVDFCVVDLERQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLRSSTDDPFDTFLVVSFxxxxxxxxxxxxxxxxxxxxxGFCSQTQTLFCHDAIYNQLVQVTSGSVRLVSSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYLEIGDGILTEVKHAQLEYEISCLDINPIGENPSYSQIAAVGMWTDISVRIFSLPDLNLITKEHLGGEIIPRSVLLCAFEGISYLLCALGDGHLLNFLLNMKTGELTDRKKVSLGTQPITLRTFSSKNTTHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAKEGELTIGTIDDIQKLHIRSIPLGEHPRRICHQEQSRTFAICSLKNQSCAEESEMHFVRLLDDQTFEFISTYPLDTFEYGCSILSCSFSDDSNVYYCVGTAYVLPEENEPTKGRILVFIVEDGKLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLIYKHEEGAIEERARDYNANWMSAVEILDDDIYLGAENNFNLFTVRKNSEGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDSDVGQIPTVIFGTVNGVIGVIASLPHEQYLFLEKLQTNLRKVIKGVGGLNHEQWRSFNNEKKTVDAKNFLDGDLIESFLDLSRTRMDEISKTMNVSVEELCKRVEELTRLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA damage-binding protein 1a Component of light signal transduction machinery. Involved in repression of photomorphogenesis in darkness by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes (E2s). Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5, HYH and LAF1. Plays a role in DNA repair by forming with DDB2 the UV-damaged DNA-binding protein complex (UV-DDB). Component of the CUL4-RBX1-DDB1-PRL1 E3 ubiquitin-protein ligase complex.confidentQ9M0V3
DNA damage-binding protein 1 Component of light signal transduction machinery. Involved in fruit pigmentation and fruit nutritional quality. Acts as a negative regulator of fruit pigmentation. Probably acts by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5.probableQ6QNU4
DNA damage-binding protein 1 Component of light signal transduction machinery. Involved in fruit pigmentation and fruit nutritional quality. Acts as a negative regulator of fruit pigmentation. Probably acts by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5.probableQ6E7D1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A0A, chain A
Confidence level:very confident
Coverage over the Query: 352-774
View the alignment between query and template
View the model in PyMOL