Citrus Sinensis ID: 004149

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-

MDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK

cccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEcccccccEEEEEEEEccHHcccccEEEEEEEEEcccccEEEEECccccccccccCEEEEcccccEEEEEEcccccccEEEEEccccccEEEEECccccccccccccccccEEEcccccEEEEEEECcccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEcccccEEEccccccccccccEEEccccccccEEEEEEEEccccccccEEEccccccCEEEEEccccccccccccccccccccccCEECccccccccccCCcccccEEEEEEccccccccccccccEEEEEEcccccccccccCEEEEEEccccccccccccccccccccccccccccEEEEEEEEccEEEEEEEEcccccEEEEcccccccCEEEEECcccEEEEEEEcccccccEEEEEECccccccEEEEEccccccccccHHHcccccccccCEECccccccccccccccccEEEEEEEccccccccccccEEEEEcccccccccccccHHHHHHHHcccEEEEEccccccccHHHHHHccccccccccHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHccccccEEEEEcccccccHHHHccccccccccHHHcccccccccccccccHHHHHHHHHcccccccccccccEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcc

*************************SLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPS*SK****************CNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKE**SEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Acylamino-acid-releasing enzyme	This enzyme catalyzes the hydrolysis of the N-terminal peptide bond of an N-acetylated peptide to generate an N-acetylated amino acid and a peptide with a free N-terminus. It preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser.	probable	P13798
Acylamino-acid-releasing enzyme	This enzyme catalyzes the hydrolysis of the N-terminal peptide bond of an N-acetylated peptide to generate an N-acetylated amino acid and a peptide with a free N-terminus. It preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser.	probable	P13676
Acylamino-acid-releasing enzyme	This enzyme catalyzes the hydrolysis of the N-terminal peptide bond of an N-acetylated peptide to generate an N-acetylated amino acid and a peptide with a free N-terminus. It preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser.	probable	Q8R146

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A5S, chain A
Confidence level:very confident
Coverage over the Query: 47-266,278-287,305-373,395-771
View the alignment between query and template
View the model in PyMOL

Template: 3AZO, chain A
Confidence level:very confident
Coverage over the Query: 53-178,210-287,305-370,381-771
View the alignment between query and template
View the model in PyMOL

Template: 3O4H, chain A
Confidence level:very confident
Coverage over the Query: 24-145,156-174,218-267,279-287,305-370,390-771
View the alignment between query and template
View the model in PyMOL

Template: 3FM0, chain A
Confidence level:confident
Coverage over the Query: 49-263,279-338,350-419
View the alignment between query and template
View the model in PyMOL