Citrus Sinensis ID: 004165


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770
MEETSRSSNREDQTNVFRNKNEDQITVMEPNISKQTKEAWRSKDAQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRMIEINDRQGAEDLVKEVKEAKSSEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVIKDD
cccccccccccccccccccccccccHHccccHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHcHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccHHHHHcccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccccccccHHHHHHHHHHcccHHHHHcccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccHHHHHccccccccccc
cccccccccccccccHHcccccccEEEEcccccHHHHHHHHcHHHHHcccccHHHHHHHHHHccccccEEEEEcccccccccEEcccccccccccccccEEEcccHccHHHHHHHHccccHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHcccccccHHHHHHHcccHHHHHHHHHHcccHHcccccccccHHHHHHHcccHHHHHHHHHccccHHHccccccccHHHHHHHHcHHHHHHHHHHHcHHHHHccccccccHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHccccccHHHHccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHccHHHHHcccccccHHHHHHHccHHHHHHHHHHcccHHHHEEEEccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHEEEHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEccccccEEEEcc
meetsrssnredqtnvfrnknedqitvmepniskqTKEAWRSkdaqkneyygpYCLLYAMIESNDWQGVEDFVKQTKEAqsskdaqgneyydLSWTLCRMIEINDRQGAEDLVKEVKEakssedaqrdeyygrywplykmtqkndwrgvedfvgehpdaltdkidgHKTIFHLIAMLLVDvesdegtclvdnlasivVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYkpdltnvrdnegtLPVQLAALYGHKDTFQYLlkethgvdiysgndGALVLANLIHARLYDVALDLLklhptigrdniDSRRIVLKTLAkkpyafasgsrLGRLQRLIYNCIparkelvpsiqtnddetvdrdvenltvtskihskkptpfgstqqiptTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQgviwtnpenrDRLLGAMFTAARLGIPEFVNEFIMAYDnsahlfaqdeHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHlagrlvpssevAGAALQMQRELQWFKMVEnlvhpsdreaeNKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAaftvpggsdsrgipnylhepsfMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWreltghdvaakgnyknrvikdd
meetsrssnredqtnvfrnknedqitvmepniskqtkeawrskdaqkNEYYGPYCLLYAMIESNDWQGVEDFVKQTKeaqsskdaqgneYYDLSWTLCRMIEINDRQGAEDLVKEvkeakssedaqrdeyygrYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLhptigrdnidsrRIVLKTLAKkpyafasgsrlgrLQRLIYNCIPArkelvpsiqtnddetvdrDVENLTVtskihskkptpfgstqqiPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHpsdreaenklrqtprevftQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTswreltghdvaakgnyknrvikdd
MEETSRSSNREDQTNVFRNKNEDQITVMEPNISKQTKEAWRSKDAQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRMIEINDRQGAEDLVKEVKEAKSSEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTlfallqfplllDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVIKDD
***********************************************NEYYGPYCLLYAMIESNDWQGVEDFV**************NEYYDLSWTLCRMIEIND***********************EYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPS**********************************QIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLV********************************WMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNY********
******************NKNEDQITVMEPNIS**************NEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRMIEINDRQGAEDLVKEVKE************YGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPRE*****************KETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVI***
*************TNVFRNKNEDQITVMEPNIS*********KDAQKNEYYGPYCLLYAMIESNDWQGVEDFVK***********QGNEYYDLSWTLCRMIEINDRQGAEDLVKEVKEAKSSEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVIKDD
*************TNVFRNKNEDQITVMEPNISKQTKEAWRSKDAQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRMIEINDRQGAEDLVKEVKEAKSSEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVIKDD
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEETSRSSNREDQTNVFRNKNEDQITVMEPNISKQTKEAWRSKDAQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRMIEINDRQGxxxxxxxxxxxxxxxxxxxxxYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQTSWRELTGHDVAAKGNYKNRVIKDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query770 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.172 0.225 0.323 2e-08
Q9P0K7 980 Ankycorbin OS=Homo sapien yes no 0.181 0.142 0.289 1e-07
Q5U312 978 Ankycorbin OS=Rattus norv yes no 0.092 0.072 0.389 6e-07
Q9EP71 979 Ankycorbin OS=Mus musculu yes no 0.092 0.072 0.376 3e-06
Q38998857 Potassium channel AKT1 OS no no 0.089 0.080 0.388 1e-05
P0C550935 Potassium channel AKT1 OS N/A no 0.085 0.070 0.391 3e-05
Q0JKV1935 Potassium channel AKT1 OS no no 0.085 0.070 0.391 4e-05
Q8R3P91054 Ankyrin repeat domain-con no no 0.233 0.170 0.258 9e-05
Q9ET47 871 Espin OS=Mus musculus GN= no no 0.087 0.076 0.333 0.0001
Q63618 837 Espin OS=Rattus norvegicu no no 0.092 0.084 0.328 0.0001
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 70/139 (50%), Gaps = 6/139 (4%)

Query: 579 KELVKEGEKWMKETASSCSVVAALIITVVFAAAFTVPGGSDSRGIPNYLHEPSFMIFAIS 638
           KEL K   + +    +S +VVA L  TV FAA FTVPGG ++ G    +   SF IF I 
Sbjct: 405 KELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVVGRASFKIFFIF 464

Query: 639 DMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHI 698
           + LALF+S+  V++ + ++      E  +V +  KL      ++ +     VAF A+ +I
Sbjct: 465 NALALFTSLAVVVVQITLVRGETKAEKRVVEVINKL------MWLASMCTSVAFLASSYI 518

Query: 699 SLSHKWNLVFIPIALVGFV 717
            +  K       + +VG V
Sbjct: 519 VVGRKNEWAAELVTVVGGV 537





Arabidopsis thaliana (taxid: 3702)
>sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 Back     alignment and function description
>sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=2 SV=2 Back     alignment and function description
>sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 Back     alignment and function description
>sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 Back     alignment and function description
>sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8R3P9|ANR32_MOUSE Ankyrin repeat domain-containing protein 32 OS=Mus musculus GN=Ankrd32 PE=2 SV=3 Back     alignment and function description
>sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 Back     alignment and function description
>sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query770
255544802590 ankyrin repeat-containing protein, putat 0.736 0.961 0.438 1e-125
255552378580 ankyrin repeat-containing protein, putat 0.728 0.967 0.388 1e-108
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.729 0.331 0.400 1e-107
296087932655 unnamed protein product [Vitis vinifera] 0.767 0.902 0.401 1e-106
356532648739 PREDICTED: uncharacterized protein LOC10 0.698 0.728 0.394 1e-103
225449665810 PREDICTED: uncharacterized protein LOC10 0.746 0.709 0.393 1e-103
296087936750 unnamed protein product [Vitis vinifera] 0.758 0.778 0.386 1e-101
359483665762 PREDICTED: ankyrin repeat-containing pro 0.728 0.736 0.376 1e-99
225449663757 PREDICTED: uncharacterized protein LOC10 0.722 0.734 0.387 5e-99
296088578718 unnamed protein product [Vitis vinifera] 0.749 0.803 0.376 9e-99
>gi|255544802|ref|XP_002513462.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223547370|gb|EEF48865.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 271/618 (43%), Positives = 360/618 (58%), Gaps = 51/618 (8%)

Query: 133 RYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDN 192
           R+  LYK      W   +    E P ALT KI G + I      L V + +      V N
Sbjct: 8   RHLALYKAAVHGQWITAKRIFDEDPSALTAKISGFEEI-----ALYVAITAGHSIEFVQN 62

Query: 193 LASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAAL 252
           + +++  + +   NR G  ALH  A  GNL+A K+L+K  P LT  R+     P+  AA 
Sbjct: 63  IVNLMSEDLIGTVNRDGNNALHAAAMVGNLEAAKILVKKNPTLTQGRNVLNATPLHYAAS 122

Query: 253 YGHKDTFQYLLKETHG--VDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDS 310
           Y H++T ++LL  T       ++  DG  +L +LI A  Y +AL LLK +P + R     
Sbjct: 123 YAHQETVRFLLPVTRDEYPSPFTDKDGVRLLNSLITADFYGLALHLLKRYPALARGTDQY 182

Query: 311 RRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVDR--DVENLT 368
               L  LA+KP AF SGSRLG     +Y+   A         + D ET  +  DVEN  
Sbjct: 183 GFTSLDMLARKPQAFPSGSRLGFRHSFLYHYCAA--------NSVDTETFHQGGDVENQV 234

Query: 369 VTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVE 428
             S+ + +K   F                               ++ I    L H + VE
Sbjct: 235 GGSEKYCQKRFSF-------------------------------LRDIDKTLLMHKQAVE 263

Query: 429 IVRIICQGVIWTNPENRDRLLGAMF-TAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFD 487
           ++R +    +  N      LLG+   TA + GI EFV E I +Y  S      D   IF 
Sbjct: 264 LLRNLISEALKANESQLHSLLGSSTQTATKFGIQEFVAEAIKSYPYSVWFRDGDGCTIFH 323

Query: 488 LAVLHRREKVFNLIHGV-NFTTFLFSFRDFLGNNILHLAGRLVPSSEVAGAALQMQRELQ 546
           LA+ HR+EK+FNL++ + N    + S  D LGN +LHLAG L PSS+++GAALQMQRELQ
Sbjct: 324 LAIKHRQEKIFNLLYQIGNHKHIITSLADSLGNTMLHLAGTLQPSSKISGAALQMQRELQ 383

Query: 547 WFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEGEKWMKETASSCSVVAALIITV 606
           WFK VE ++ PS +E ++K  +TPR+VFT+ HK LV++GEKWMK+TA+SC+ VAAL+ITV
Sbjct: 384 WFKEVEKVIQPSYKELKDKNGRTPRQVFTEGHKSLVEQGEKWMKDTATSCATVAALVITV 443

Query: 607 VFAAAFTVPGGSDS-RGIPNYLHEPSFMIFAISDMLALFSSITSVLMFLGILTSRYAEED 665
           VFAAAFTVPGG++S +GIP YL+E +F+IFAISD L LFSS TS+LMFLGILTSRY+E D
Sbjct: 444 VFAAAFTVPGGNNSDQGIPIYLNETAFVIFAISDALGLFSSSTSLLMFLGILTSRYSEGD 503

Query: 666 FLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVFIPIALVGFVPVTLFALL 725
           FL +LP +L IGL+TLFFSIASM+ AF A  H+ L H+   + +PI LV   PVTLFALL
Sbjct: 504 FLKALPMRLSIGLITLFFSIASMLAAFSAAFHLVLFHRVKWIAVPIGLVACAPVTLFALL 563

Query: 726 QFPLLLDMYSSTYGRGIF 743
           QFPLL +M SST+GR +F
Sbjct: 564 QFPLLSEMISSTFGRSVF 581




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255552378|ref|XP_002517233.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543604|gb|EEF45133.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087932|emb|CBI35215.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532648|ref|XP_003534883.1| PREDICTED: uncharacterized protein LOC100814269 [Glycine max] Back     alignment and taxonomy information
>gi|225449665|ref|XP_002263931.1| PREDICTED: uncharacterized protein LOC100245348 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087936|emb|CBI35219.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449663|ref|XP_002263810.1| PREDICTED: uncharacterized protein LOC100260956 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088578|emb|CBI37569.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query770
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.427 0.491 0.419 1.8e-76
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.440 0.542 0.403 3.7e-72
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.424 0.542 0.444 2.6e-71
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.338 0.454 0.410 7.9e-60
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.371 0.824 0.409 2.4e-50
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.176 0.224 0.309 1.3e-14
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.158 0.206 0.317 4.7e-12
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.212 0.247 0.301 6.3e-11
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.211 0.259 0.286 1.5e-10
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.331 0.367 0.280 2.5e-10
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 1.8e-76, Sum P(2) = 1.8e-76
 Identities = 143/341 (41%), Positives = 210/341 (61%)

Query:   413 IKVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG-AMFTAARLGIPEFVNEFIMAY 471
             I  ++  K+ H++  +++  I +  +    + R   +  A+  A R G  +F+ E I   
Sbjct:   323 IDEVYRLKVMHLQAKKLLLGISEETLALGLKERSETVDEALLFAVRYGNVDFLVEMIR-- 380

Query:   472 DNSAHLFA---QDEHRIFDLAVLHRREKVFNLIHGVNFTTFLF-SFRDFLGNNILHLAGR 527
             +NS  L++        +F LAV  R+EKVF+L++G++   +L  + +D  GN +LHLAG 
Sbjct:   381 NNSELLWSTRTSSSSTLFLLAVEFRQEKVFSLLYGLDDRKYLLLADKDCDGNGVLHLAGF 440

Query:   528 LVPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKE 584
               P S+   V GA LQ+QRELQWFK VE +    ++E  N   QTP E+FT+EH+ L +E
Sbjct:   441 PSPPSKLSSVVGAPLQLQRELQWFKEVERIAPEIEKERVNTEEQTPIEIFTKEHQGLRQE 500

Query:   585 GEKWMKETASSCSVVAALIITVVFAAAFTVPGGSD--SRGIPNYLHEPSFMIFAISDMLA 642
              EKWMK+TA SCS+VAALI+TV FAA FTVPGG+D  S+G P +L +  F+IF +SD+++
Sbjct:   501 AEKWMKDTAMSCSLVAALIVTVTFAAVFTVPGGTDDNSKGKPFHLRDRRFIIFIVSDLIS 560

Query:   643 LFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSH 702
              F+S TSVL+FLGILT+RY+ +DFLV LP K+I GL  LF SIA+M++AF + +   +  
Sbjct:   561 CFASCTSVLIFLGILTARYSFDDFLVFLPTKMIAGLSILFVSIAAMLIAFSSALFTMMGK 620

Query:   703 KWNLVFIPIALVGFVPVTXXXXXXXXXXXDMYSSTYGRGIF 743
             +   +  P  L   +P             +M  STYG+GIF
Sbjct:   621 EGKWIVAPTILFACLPALLFVLLQYPLLKEMIFSTYGKGIF 661


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query770
pfam13962114 pfam13962, PGG, Domain of unknown function 4e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
COG0531 466 COG0531, PotE, Amino acid transporters [Amino acid 0.001
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score =  114 bits (288), Expect = 4e-30
 Identities = 43/120 (35%), Positives = 62/120 (51%), Gaps = 14/120 (11%)

Query: 586 EKWMKETASSCSVVAALIITVVFAAAFTVPGG------SDSRGIPNYLHEPS-FMIFAIS 638
            +W+++T +S  VVA LI TV FAA FT PGG          G P    +P  F  F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 639 DMLALFSSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHI 698
           + +A  +S+ +V++ L      Y    F   LPR L+  L  L+ S+ S+MVAF A  + 
Sbjct: 61  NTIAFVASLVAVILLL------YIVPSFSRRLPR-LLALLTLLWLSLLSLMVAFAAGSYR 113


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 770
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02792631 ankyrin-like protein; Provisional 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02792631 ankyrin-like protein; Provisional 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
TIGR00870743 trp transient-receptor-potential calcium channel p 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PHA02795437 ankyrin-like protein; Provisional 99.92
PF13962113 PGG: Domain of unknown function 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.88
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.87
TIGR00870743 trp transient-receptor-potential calcium channel p 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
KOG0514452 consensus Ankyrin repeat protein [General function 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.8
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.8
PHA02741169 hypothetical protein; Provisional 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.77
PHA02884300 ankyrin repeat protein; Provisional 99.77
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.75
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.73
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.7
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.61
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.58
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.58
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.56
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.45
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.44
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.31
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.27
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.27
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.26
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.25
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.25
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.19
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.19
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.18
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.18
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.63
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.49
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.48
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.47
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.45
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.39
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.38
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.38
PF1360630 Ank_3: Ankyrin repeat 98.34
PF1360630 Ank_3: Ankyrin repeat 98.31
KOG0522560 consensus Ankyrin repeat protein [General function 98.3
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.29
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.27
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.26
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.25
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.23
KOG0522560 consensus Ankyrin repeat protein [General function 98.17
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.99
KOG0511516 consensus Ankyrin repeat protein [General function 97.81
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.79
KOG0520975 consensus Uncharacterized conserved protein, conta 97.76
KOG0520975 consensus Uncharacterized conserved protein, conta 97.74
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.64
KOG2384223 consensus Major histocompatibility complex protein 97.59
KOG2384223 consensus Major histocompatibility complex protein 97.36
KOG0511516 consensus Ankyrin repeat protein [General function 97.28
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.31
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.28
KOG2505591 consensus Ankyrin repeat protein [General function 94.99
KOG2505591 consensus Ankyrin repeat protein [General function 94.93
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.02
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.89
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.26
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 89.55
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.54
PF06570206 DUF1129: Protein of unknown function (DUF1129); In 80.49
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=3.4e-43  Score=377.78  Aligned_cols=436  Identities=15%  Similarity=0.119  Sum_probs=327.4

Q ss_pred             ccccccCCCchhHHHHHhcCChHHHHHHHHhhHHHHhccCCCCCcccchhHH-HHHHHHhcCHHHHHHHHHHHHhccccc
Q 004165           45 AQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWT-LCRMIEINDRQGAEDLVKEVKEAKSSE  123 (770)
Q Consensus        45 ~~~~d~~g~t~Lh~A~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~~~t-L~~A~~~g~~~~v~~Ll~~~~~~~~~~  123 (770)
                      ....+..|+|++|.|+..+.         .      .+.-...+..|..+++ ||+|++.+..+.++.|++++       
T Consensus        54 ~~~~~~~gd~~~~~~~~~~y---------~------~~~~~~~~a~D~~~n~~l~~a~~~~~~~~i~~Lls~g-------  111 (929)
T KOG0510|consen   54 TPGKRAFGDTELHHASARNY---------I------LSKLAISYAKDSADNTPLHAAVEYNQGDKIQVLLSYG-------  111 (929)
T ss_pred             cchhhhhchhHHHHHHhhcc---------h------hhhhhhhhhhhcccCchhHHHhhcchHHHHHHHHhcC-------
Confidence            44567789999999999885         1      2223345566666666 99999999999999999554       


Q ss_pred             cccccc-cCCCCcHHHHHHHcCCHHHHHHHHhhCCcccccccCCCCCHHHHHHhccccccCCchHHHHHHHHHcCChhhh
Q 004165          124 DAQRDE-YYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEAL  202 (770)
Q Consensus       124 ~~~~~~-~~~g~t~L~~A~~~g~~~~v~~LL~~~~~~~~~~d~~g~t~Lh~~A~~~~~~~~g~~~~iv~~Ll~~~~~~~~  202 (770)
                       ++... +..+.+|+|+|+..|+.++++.|+ +++.++|..|..|.||||+ ||.     .++ .|..+.|++.|  +++
T Consensus       112 -ad~~~~n~~~~aplh~A~~~~~~s~L~~Ll-~~~~dvnl~de~~~TpLh~-A~~-----~~~-~E~~k~Li~~~--a~~  180 (929)
T KOG0510|consen  112 -ADTPLRNLNKNAPLHLAADSGNYSCLKLLL-DYGADVNLEDENGFTPLHL-AAR-----KNK-VEAKKELINKG--ADP  180 (929)
T ss_pred             -CCCChhhhhccCchhhccccchHHHHHHHH-HhcCCccccccCCCchhhH-HHh-----cCh-HHHHHHHHhcC--CCC
Confidence             33322 334889999999999999999666 5579999999999999999 999     999 99889999999  999


Q ss_pred             ccccCCCCcHHHHHHHcCCHHHHHHHHh-----cCCCCccCCCCCCCcHHHHHHHcCChhHHHHHHhhcCCCCc------
Q 004165          203 ARQNRHGRTALHFCAAKGNLKAIKVLMK-----YKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDI------  271 (770)
Q Consensus       203 ~~~d~~g~T~Lh~A~~~g~~~iv~~Ll~-----~~~~l~~~~d~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~------  271 (770)
                      ...|.+|++|+|.|++.|..++.+..+.     .+.. ++..|..|.||||.|+..|+.++++..+++|+....      
T Consensus       181 ~K~~~~~~~~iH~aa~s~s~e~mEi~l~~~g~~r~~~-in~~~n~~~~pLhlAve~g~~e~lk~~L~n~~~~a~~~~~~~  259 (929)
T KOG0510|consen  181 CKSDIDGNFPIHEAARSGSKECMEIFLPEHGYERQTH-INFDNNEKATPLHLAVEGGDIEMLKMCLQNGKKIADVQLDAM  259 (929)
T ss_pred             CcccCcCCchHHHHHHhcchhhhhhhhccccchhhcc-cccccCCCCcchhhhhhcCCHHHHHHHHhCccccchhhhHHH
Confidence            9999999999999999999999999999     4566 789999999999999999999999999998765432      


Q ss_pred             --------ccCCCCchHHHHHHHhchHHHHHHHHhhCCCCcccCCCCCCCHHHHHHhCCCcccCCCcchhhhHHHhhccc
Q 004165          272 --------YSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIP  343 (770)
Q Consensus       272 --------~~~~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~Aa~~~~~~~s~~~~~~~~~~i~~~~~  343 (770)
                              ..|++|.||||+|++.|+.+.++.|+..|+++. .+++++.||||.||..|+       +.-+++++.    
T Consensus       260 ~q~kelv~~~d~dg~tpLH~a~r~G~~~svd~Ll~~Ga~I~-~kn~d~~spLH~AA~yg~-------~ntv~rLL~----  327 (929)
T KOG0510|consen  260 QQEKELVNDEDNDGCTPLHYAARQGGPESVDNLLGFGASIN-SKNKDEESPLHFAAIYGR-------INTVERLLQ----  327 (929)
T ss_pred             HHHHHHhhcccccCCchHHHHHHcCChhHHHHHHHcCCccc-ccCCCCCCchHHHHHccc-------HHHHHHHHh----
Confidence                    468899999999999999999999999999998 899999999999999883       222222222    


Q ss_pred             cccccCCCCCCCCCcccccccccccccccccCCCCCCCCCCcccccccchhhhHhHHHHHHHHhhcCCchHHHHHhhhhh
Q 004165          344 ARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTH  423 (770)
Q Consensus       344 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  423 (770)
                                                                                                      
T Consensus       328 --------------------------------------------------------------------------------  327 (929)
T KOG0510|consen  328 --------------------------------------------------------------------------------  327 (929)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHHhhccccCCccccCCcchHHHHHHHcCcHHHHHHHHHhCCcccc--ccccCCchHHHHHHhcChhHHHHHH
Q 004165          424 MRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAH--LFAQDEHRIFDLAVLHRREKVFNLI  501 (770)
Q Consensus       424 ~~~~~~l~~l~~~~~~~~~~~~~~g~tpLh~Aa~~G~~eiv~~LL~~~~~~~~--~~d~~G~T~LH~Av~~g~~~iv~~L  501 (770)
                                .......+.++. .|.||||+|+++||..+++.||++++...+  ..|++|.||||.|+++|+..+|++|
T Consensus       328 ----------~~~~rllne~D~-~g~tpLHlaa~~gH~~v~qlLl~~GA~~~~~~e~D~dg~TaLH~Aa~~g~~~av~~L  396 (929)
T KOG0510|consen  328 ----------ESDTRLLNESDL-HGMTPLHLAAKSGHDRVVQLLLNKGALFLNMSEADSDGNTALHLAAKYGNTSAVQKL  396 (929)
T ss_pred             ----------CcCccccccccc-cCCCchhhhhhcCHHHHHHHHHhcChhhhcccccccCCchhhhHHHHhccHHHHHHH
Confidence                      111112222221 699999999999999999999999998665  5599999999999999999999999


Q ss_pred             hhcCcccccccccccCCCchhhhhhccCCC-----C-CccchHHhhHHHHHHHHHhhhcCCC-CchhhhhccCCChhHHh
Q 004165          502 HGVNFTTFLFSFRDFLGNNILHLAGRLVPS-----S-EVAGAALQMQRELQWFKMVENLVHP-SDREAENKLRQTPREVF  574 (770)
Q Consensus       502 l~~~~~~~~~n~~D~~G~T~LHlAa~~g~~-----~-~v~~~~lq~~~~l~w~~~v~~l~~~-~~~~~~N~~G~Tp~dl~  574 (770)
                      +.+|   +++..+|+.|.+++|+--....+     + .-..+...+++-+.  +.++..+.- .......++++||.+.-
T Consensus       397 i~~G---a~I~~~n~~g~SA~~~~~~~~~p~~~~~~~~n~c~~~~~i~~~p--e~~e~vlD~c~l~~~e~~~~~~~~Q~~  471 (929)
T KOG0510|consen  397 ISHG---ADIGVKNKKGKSAFDTRPDRCLPVFVHRSPFNKCPTTELIEPLP--ECFEIVLDFCILKSQERKDSPTPLQDE  471 (929)
T ss_pred             HHcC---CceeeccccccccccccccccccHHHhhCCCCCcchhhhhccch--HHHHHHHHHHHHHHhhccCCCChhhhh
Confidence            9999   99999999999999962211111     0 00011122221111  111111110 11233445678887732


Q ss_pred             ---------hHHHHHHHHH-------hHHHHHH----hhhhhHHHHHHHHHHHHHhhhcCCCCC-CCCC
Q 004165          575 ---------TQEHKELVKE-------GEKWMKE----TASSCSVVAALIITVVFAAAFTVPGGS-DSRG  622 (770)
Q Consensus       575 ---------~~~~~~l~~~-------~~~~~~~----~~~~~~vva~Liatv~faa~~t~Pgg~-~~~G  622 (770)
                               .++..++++-       --+|.+-    -..++.+.+..++.+|+=.-.+.||-- |+.|
T Consensus       472 ~~~~~~~mv~~~~~eLL~HPL~ssfL~mKW~~~g~~~~~~nL~~Y~lFlv~lT~Yv~~~~~~~~~n~~~  540 (929)
T KOG0510|consen  472 AAPILNIMVDKEQIELLEHPLSSSFLFMKWNRYGKYFHLNNLLIYSLFLVSLTIYVLLIKAGMAFNSSG  540 (929)
T ss_pred             hhhHHHHHhhhhHHHHhcChhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccc
Confidence                     2233333321       1256543    233467777778888877777777632 3344



>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06570 DUF1129: Protein of unknown function (DUF1129); InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query770
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-07
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 9e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 6e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 7e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-05
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 6e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-04
1uoh_A226 Human Gankyrin Length = 226 1e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-04
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-04
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 5e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 6e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-04
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 1e-07, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Query: 206 NRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKE 265 +R G T LH A +L+ ++VL+K+ D+ N DN+G+ P+ LAAL+GH + + LLK Sbjct: 44 DRKGNTPLHLAADYDHLEIVEVLLKHGADV-NAHDNDGSTPLHLAALFGHLEIVEVLLK- 101 Query: 266 THGVDI 271 HG D+ Sbjct: 102 -HGADV 106
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query770
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-05
2rfa_A232 Transient receptor potential cation channel subfa 5e-11
2rfa_A232 Transient receptor potential cation channel subfa 1e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-07
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
2etb_A256 Transient receptor potential cation channel subfam 3e-08
2etb_A256 Transient receptor potential cation channel subfam 7e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 6e-07
2pnn_A273 Transient receptor potential cation channel subfa 8e-05
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 70.3 bits (171), Expect = 2e-12
 Identities = 88/669 (13%), Positives = 176/669 (26%), Gaps = 187/669 (27%)

Query: 13  QTNVFRNKNEDQITVMEPNISKQ---------TKEAWRSKD-----AQKNEYYGPYCLLY 58
           +T   + + +D ++V E                K     ++       K+   G    L+
Sbjct: 10  ETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTL-RLF 68

Query: 59  AMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWTLCRM-IEINDRQGAEDLVKEVK 117
             + S   + V+ FV++                +  + +  +  E         +  E  
Sbjct: 69  WTLLSKQEEMVQKFVEEVLR------------INYKFLMSPIKTEQRQPSMMTRMYIE-- 114

Query: 118 EAKSSEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAM- 176
                   QRD  Y       K    N  R       +   AL +       +     + 
Sbjct: 115 --------QRDRLYNDNQVFAKY---NVSR--LQPYLKLRQALLELRPAKNVLID--GVL 159

Query: 177 ------LLVDVESDE---------------GTC--------LVDNLASIVVPEALARQNR 207
                 + +DV                     C        ++  L   + P   +R + 
Sbjct: 160 GSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDH 219

Query: 208 HGRTALHFCAAKGNLKAIKVLMKYKPDLT---NVRDNEG-------------TLPVQLAA 251
                L   + +  L+ +     Y+  L    NV++ +              T   Q+  
Sbjct: 220 SSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTD 279

Query: 252 LYGHKDTFQYLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHP----TIG--- 304
                 T    L   H     + ++   +L   +  R  D+  ++L  +P     I    
Sbjct: 280 FLSAATTTHISLD--HHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESI 337

Query: 305 RDNIDSRRIVLKTLAKKPYAFASGSRLGRL-----QRLIYNC--------IPARKELVPS 351
           RD +       K +          S L  L     +++            IP    L+  
Sbjct: 338 RDGLA-TWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPT--ILLSL 394

Query: 352 IQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGP 411
           I  +  ++    V N      +  K+P           T    +  ++  L         
Sbjct: 395 IWFDVIKSDVMVVVNKLHKYSLVEKQPKES--------TIS--IPSIYLEL--------- 435

Query: 412 SIKVIHDQKLTHMRTVEIVRIICQGVIWT-NPENRDRLLGAMFTAARLGIPEFVNEFIMA 470
            +K+ ++  L H   V+   I          P   D               ++    I  
Sbjct: 436 KVKLENEYAL-HRSIVDHYNIPKTFDSDDLIPPYLD---------------QYFYSHI-G 478

Query: 471 YDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNILHLAGRLVP 530
           +    HL   +      L                 F      FR FL   I H +     
Sbjct: 479 H----HLKNIEHPERMTL-----------------FRMVFLDFR-FLEQKIRHDSTAWNA 516

Query: 531 SSEVAGAALQMQRELQWF--------KMVENLVHPSDREAENKLRQTPREV----FTQEH 578
           S  +     Q++    +         ++V  ++    +  EN +     ++       E 
Sbjct: 517 SGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAED 576

Query: 579 KELVKEGEK 587
           + + +E  K
Sbjct: 577 EAIFEEAHK 585


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query770
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.74
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.63
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.63
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-53  Score=474.20  Aligned_cols=381  Identities=15%  Similarity=0.055  Sum_probs=317.4

Q ss_pred             hhccccccCCCchhHHHHHhcCChHHHHHHHHhhHHHHhccCCCCCcccchhHH-HHHHHHhcCHHHHHHHHHHHHhccc
Q 004165           43 KDAQKNEYYGPYCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWT-LCRMIEINDRQGAEDLVKEVKEAKS  121 (770)
Q Consensus        43 ~~~~~~d~~g~t~Lh~A~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~~~t-L~~A~~~g~~~~v~~Ll~~~~~~~~  121 (770)
                      .+++..+..|.||||+|+..++         .+.+++|+++|++++..+..+.| ||+|+..|+.++++.|++.+.    
T Consensus         5 ~~~~~~~~~g~t~L~~Aa~~g~---------~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~----   71 (437)
T 1n11_A            5 ISGGGGGESGLTPLHVASFMGH---------LPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA----   71 (437)
T ss_dssp             ----------CCHHHHHHHHTC---------HHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTC----
T ss_pred             CCccccCCCCCCHHHHHHHCCC---------HHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCC----
Confidence            4567778899999999999999         99999999999999999988888 999999999999999997643    


Q ss_pred             cccccccccCCCCcHHHHHHHcCCHHHHHHHHhhCCcccccccCCCCCHHHHHHhccccccCCchHHHHHHHHHcCChhh
Q 004165          122 SEDAQRDEYYGRYWPLYKMTQKNDWRGVEDFVGEHPDALTDKIDGHKTIFHLIAMLLVDVESDEGTCLVDNLASIVVPEA  201 (770)
Q Consensus       122 ~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~LL~~~~~~~~~~d~~g~t~Lh~~A~~~~~~~~g~~~~iv~~Ll~~~~~~~  201 (770)
                      ..+.   .+..|.||||+|+..|+.+++++|++. +.+++..+..|.||||+ |+.     .|+ .+++++|++.+  ++
T Consensus        72 ~~~~---~~~~g~t~L~~A~~~g~~~~v~~Ll~~-ga~~~~~~~~g~t~L~~-A~~-----~g~-~~~v~~Ll~~~--~~  138 (437)
T 1n11_A           72 KVNA---KAKDDQTPLHCAARIGHTNMVKLLLEN-NANPNLATTAGHTPLHI-AAR-----EGH-VETVLALLEKE--AS  138 (437)
T ss_dssp             CSSC---CCTTSCCHHHHHHHHTCHHHHHHHHHH-TCCTTCCCTTCCCHHHH-HHH-----HTC-HHHHHHHHHTT--CC
T ss_pred             CCCC---CCCCCCCHHHHHHHCCCHHHHHHHHhC-CCCCCCCCCCCCcHHHH-HHH-----cCC-HHHHHHHHhCC--CC
Confidence            2221   234599999999999999999977754 88999999999999999 999     999 99999999999  88


Q ss_pred             hccccCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccCCCCCCCcHHHHHHHcCChhHHHHHHhhcCCCCcccCCCCchHH
Q 004165          202 LARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLKETHGVDIYSGNDGALVL  281 (770)
Q Consensus       202 ~~~~d~~g~T~Lh~A~~~g~~~iv~~Ll~~~~~l~~~~d~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~L  281 (770)
                      .+..+..|.||||+|+..|+.+++++|++.+++ ++..+..|.||||+|+..|+.+++++|+++|++++ ..+.+|.|||
T Consensus       139 ~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~-~~~~~g~t~L  216 (437)
T 1n11_A          139 QACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH-SPAWNGYTPL  216 (437)
T ss_dssp             SCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSC-CCCTTCCCHH
T ss_pred             CcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-CcCCCCCCHH
Confidence            888999999999999999999999999999999 89999999999999999999999999999999888 5889999999


Q ss_pred             HHHHHhchHHHHHHHHhhCCCCcccCCCCCCCHHHHHHhCCCcccCCCcchhhhHHHhhccccccccCCCCCCCCCcccc
Q 004165          282 ANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYNCIPARKELVPSIQTNDDETVD  361 (770)
Q Consensus       282 h~A~~~~~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~Aa~~~~~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  361 (770)
                      |+|+..|+.+++++|++.+++++ ..+..|.||||+|+..++       ...++.+                        
T Consensus       217 ~~A~~~~~~~~~~~Ll~~g~~~~-~~~~~g~t~L~~A~~~g~-------~~~v~~L------------------------  264 (437)
T 1n11_A          217 HIAAKQNQVEVARSLLQYGGSAN-AESVQGVTPLHLAAQEGH-------AEMVALL------------------------  264 (437)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTT-CCCTTCCCHHHHHHHTTC-------HHHHHHH------------------------
T ss_pred             HHHHHcCCHHHHHHHHHcCCCCC-CCCCCCCCHHHHHHHCCC-------HHHHHHH------------------------
Confidence            99999999999999999999887 789999999999998873       1122222                        


Q ss_pred             cccccccccccccCCCCCCCCCCcccccccchhhhHhHHHHHHHHhhcCCchHHHHHhhhhhHHHHHHHHHHhhccccCC
Q 004165          362 RDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQKLTHMRTVEIVRIICQGVIWTN  441 (770)
Q Consensus       362 ~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~l~~~~~~~~  441 (770)
                                                                                              .+.....+
T Consensus       265 ------------------------------------------------------------------------l~~~~~~~  272 (437)
T 1n11_A          265 ------------------------------------------------------------------------LSKQANGN  272 (437)
T ss_dssp             ------------------------------------------------------------------------HTTTCCTT
T ss_pred             ------------------------------------------------------------------------HhcCCCCC
Confidence                                                                                    11111111


Q ss_pred             ccccCCcchHHHHHHHcCcHHHHHHHHHhCCccccccccCCchHHHHHHhcChhHHHHHHhhcCcccccccccccCCCch
Q 004165          442 PENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFLGNNI  521 (770)
Q Consensus       442 ~~~~~~g~tpLh~Aa~~G~~eiv~~LL~~~~~~~~~~d~~G~T~LH~Av~~g~~~iv~~Ll~~~~~~~~~n~~D~~G~T~  521 (770)
                      .. ...|.||||.|+..|+.++++.|++.+.+ ++.+|..|+||||+|+.+|+.+++++|++.+   .++|.+|..|+||
T Consensus       273 ~~-~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g---ad~n~~~~~g~t~  347 (437)
T 1n11_A          273 LG-NKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQHQ---ADVNAKTKLGYSP  347 (437)
T ss_dssp             CC-CTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHHHHHHHSSCSHHHHHHHHTT---CCTTCCCTTSCCH
T ss_pred             CC-CCCCCCHHHHHHHcCCHHHHHHHHhCCcc-CCCCCCCCCCHHHHHHHcCcHHHHHHHHhcC---CCCCCCCCCCCCH
Confidence            11 12678899999999999999999988776 7788889999999999999999999999887   8889999999999


Q ss_pred             hhhhhccCCCCCccchHHhhHHHHHHHHHhhhcC-CCCchhhhhccCCChhHHhhHH
Q 004165          522 LHLAGRLVPSSEVAGAALQMQRELQWFKMVENLV-HPSDREAENKLRQTPREVFTQE  577 (770)
Q Consensus       522 LHlAa~~g~~~~v~~~~lq~~~~l~w~~~v~~l~-~~~~~~~~N~~G~Tp~dl~~~~  577 (770)
                      ||+|++.|+.+                 .|+.++ .+.+.+.+|++|+||++++.+.
T Consensus       348 L~~A~~~g~~~-----------------iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~  387 (437)
T 1n11_A          348 LHQAAQQGHTD-----------------IVTLLLKNGASPNEVSSDGTTPLAIAKRL  387 (437)
T ss_dssp             HHHHHHTTCHH-----------------HHHHHHHTTCCSCCCCSSSCCHHHHHHHT
T ss_pred             HHHHHHCChHH-----------------HHHHHHHCcCCCCCCCCCCCCHHHHHHHc
Confidence            99999988742                 122222 3455778888999999987654



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 770
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.004
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Lin-12
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 59.7 bits (143), Expect = 3e-10
 Identities = 11/60 (18%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 205 QNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQYLLK 264
           Q+  G+T +   A +G ++ +  L++    +    D       QLA    H +      +
Sbjct: 217 QDEDGKTPIMLAAQEGRIEVVMYLIQQGASV-EAVDATDHTARQLAQANNHHNIVDIFDR 275


>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query770
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.2e-43  Score=382.35  Aligned_cols=342  Identities=15%  Similarity=0.040  Sum_probs=241.8

Q ss_pred             chhHHHHHhcCChHHHHHHHHhhHHHHhccCCCCCcccchhHH-HHHHHHhcCHHHHHHHHHHHHhccccccccccccCC
Q 004165           54 YCLLYAMIESNDWQGVEDFVKQTKEAQSSKDAQGNEYYDLSWT-LCRMIEINDRQGAEDLVKEVKEAKSSEDAQRDEYYG  132 (770)
Q Consensus        54 t~Lh~A~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~~~t-L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~  132 (770)
                      ||||+||..|+         .+.++.|+++|+++|..|..|.| ||+|+..|+.++++.|++++.    +.+.   .+..
T Consensus         2 TpL~~Aa~~g~---------~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~ga----di~~---~~~~   65 (408)
T d1n11a_           2 TPLHVASFMGH---------LPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA----KVNA---KAKD   65 (408)
T ss_dssp             CHHHHHHHHTC---------HHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTC----CSSC---CCTT
T ss_pred             ChHHHHHHCcC---------HHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcC----CCCC---CCCC
Confidence            99999999999         99999999999999999999988 999999999999999997653    2222   2345


Q ss_pred             CCcHHHHHHHcCCHHHHHHHHhhCC--------------------------------cccccccCCCCCHHHHHHhcccc
Q 004165          133 RYWPLYKMTQKNDWRGVEDFVGEHP--------------------------------DALTDKIDGHKTIFHLIAMLLVD  180 (770)
Q Consensus       133 g~t~L~~A~~~g~~~~v~~LL~~~~--------------------------------~~~~~~d~~g~t~Lh~~A~~~~~  180 (770)
                      |.||||+|+..|+.++++.|+....                                ...+..+..+.++|+. |+.   
T Consensus        66 g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-a~~---  141 (408)
T d1n11a_          66 DQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHV-AAK---  141 (408)
T ss_dssp             SCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHH-HHH---
T ss_pred             CCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHH-HHH---
Confidence            9999999999999999998875432                                1222333444555555 555   


Q ss_pred             ccCCchHHHHHHHHHcCChhhhccccCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccCCCCCCCcHHHHHHHcCChhHHH
Q 004165          181 VESDEGTCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLPVQLAALYGHKDTFQ  260 (770)
Q Consensus       181 ~~~g~~~~iv~~Ll~~~~~~~~~~~d~~g~T~Lh~A~~~g~~~iv~~Ll~~~~~l~~~~d~~g~tpL~~A~~~g~~~~v~  260 (770)
                        .++ .++++.|++++  ++++..+..|.+|||+|+..|+.+++++|+++|++ ++..+..|.||+|+++...+.++..
T Consensus       142 --~~~-~~~v~~ll~~~--~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~~~t~l~~~~~~~~~~~~~  215 (408)
T d1n11a_         142 --YGK-VRVAELLLERD--AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGS-PHSPAWNGYTPLHIAAKQNQVEVAR  215 (408)
T ss_dssp             --TTC-HHHHHHHHHTT--CCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCC-SCCCCTTCCCHHHHHHHTTCHHHHH
T ss_pred             --cCC-HHHHHHHHHcC--CCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCc-ccccCCCCCCcchhhhccchhhhhh
Confidence              555 55555555555  55555555555555555555555555555555555 4555555555555555555555555


Q ss_pred             HHHhhcCCCCcccCCCCchHHHHHHHhchHHHHHHHHhhCCCCcccCCCCCCCHHHHHHhCCCcccCCCcchhhhHHHhh
Q 004165          261 YLLKETHGVDIYSGNDGALVLANLIHARLYDVALDLLKLHPTIGRDNIDSRRIVLKTLAKKPYAFASGSRLGRLQRLIYN  340 (770)
Q Consensus       261 ~Ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~Aa~~~~~~~s~~~~~~~~~~i~~  340 (770)
                      .|+..+.... ..+.+|.||||+|+..++.++++.+++.+.... ..|..|.|||+.|+..+                  
T Consensus       216 ~l~~~~~~~~-~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~-~~~~~g~~~l~~a~~~~------------------  275 (408)
T d1n11a_         216 SLLQYGGSAN-AESVQGVTPLHLAAQEGHAEMVALLLSKQANGN-LGNKSGLTPLHLVAQEG------------------  275 (408)
T ss_dssp             HHHHTTCCTT-CCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTT-CCCTTCCCHHHHHHHHT------------------
T ss_pred             hhhhcccccc-ccCCCCCCHHHHHHHhCcHhHhhhhhccccccc-cccCCCCChhhhhhhcC------------------
Confidence            5555544433 345555555555555555555555555554444 45555555555555443                  


Q ss_pred             ccccccccCCCCCCCCCcccccccccccccccccCCCCCCCCCCcccccccchhhhHhHHHHHHHHhhcCCchHHHHHhh
Q 004165          341 CIPARKELVPSIQTNDDETVDRDVENLTVTSKIHSKKPTPFGSTQQIPTTYGAMLHKLHRMLWNVLMRLGPSIKVIHDQK  420 (770)
Q Consensus       341 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  420 (770)
                                                                                                      
T Consensus       276 --------------------------------------------------------------------------------  275 (408)
T d1n11a_         276 --------------------------------------------------------------------------------  275 (408)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhHHHHHHHHHHhhccccCCccccCCcchHHHHHHHcCcHHHHHHHHHhCCccccccccCCchHHHHHHhcChhHHHHH
Q 004165          421 LTHMRTVEIVRIICQGVIWTNPENRDRLLGAMFTAARLGIPEFVNEFIMAYDNSAHLFAQDEHRIFDLAVLHRREKVFNL  500 (770)
Q Consensus       421 ~~~~~~~~~l~~l~~~~~~~~~~~~~~g~tpLh~Aa~~G~~eiv~~LL~~~~~~~~~~d~~G~T~LH~Av~~g~~~iv~~  500 (770)
                        +..+.++|..........+    ..+.||||.|+..|+.++++.+++.+.+ ++.+|.+|+||||+|+++|+.+++++
T Consensus       276 --~~~i~~~Ll~~g~~~~~~~----~~~~t~L~~~~~~~~~~~~~~ll~~g~~-in~~d~~G~T~Lh~A~~~g~~~iv~~  348 (408)
T d1n11a_         276 --HVPVADVLIKHGVMVDATT----RMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTL  348 (408)
T ss_dssp             --CHHHHHHHHHHTCCTTCCC----SSCCCHHHHHHHSSCSHHHHHHHHTTCC-TTCCCTTSCCHHHHHHHTTCHHHHHH
T ss_pred             --cHHHHHHHHHCCCcccccc----ccccccchhhcccCcceeeeeecccccc-ccccCCCCCCHHHHHHHcCCHHHHHH
Confidence              3333444333222211111    1578999999999999999999998877 78999999999999999999999999


Q ss_pred             HhhcCcccccccccccCCCchhhhhhccCCC
Q 004165          501 IHGVNFTTFLFSFRDFLGNNILHLAGRLVPS  531 (770)
Q Consensus       501 Ll~~~~~~~~~n~~D~~G~T~LHlAa~~g~~  531 (770)
                      |++.|   +++|.+|++|+||||+|++.|+.
T Consensus       349 Ll~~G---Ad~n~~d~~G~t~L~~A~~~~~~  376 (408)
T d1n11a_         349 LLKNG---ASPNEVSSDGTTPLAIAKRLGYI  376 (408)
T ss_dssp             HHHTT---CCSCCCCSSSCCHHHHHHHTTCH
T ss_pred             HHHCC---CCCCCCCCCCCCHHHHHHHcCCH
Confidence            99998   89999999999999999999985



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure