Citrus Sinensis ID: 004238

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------

MSEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKTCTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTLPHSMQNPNNPNPDPRLSPVFVFVLDTCMIEEELGYARSELKRAIGLLPDNAMVGLVTFGTQAHVHELGFSDMSKVYVFRGNKEISKDQVLEQLGLSASGRRAAGGYQKAAVPNAFPNSGVSRFLLPASECEYTLNSLLDELQPDQWPVAPRTRPSRCTGVALSVATGLLGACLPGTGARIVALVGGPCTEGPGTIVSKDLSEPVRSHKDLDKDAAPFFKKAVKFYDGLAKQLVSQGHVLDLFASALDQVGVAEMKVAVEKTGGLVVLAESFGHSVFKDSFKRIFEDGEQSLGLCFNGALEIICSKDIKIQGIIGPCTSLEKVRLRGEYYAWKMCGLDKSTCLTVFFDLSSSERLNTPGTINPQLYLQFLTSFQSPEGRSVLRVTTVTRQWVDSAVSSEELVQGFDQESAAVVMARLTSLKMEMEEGFDATRWLDRSLIRLCSKFGDYRKDDPASFTLNPSFSLFPQFMFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLRAPHDDAELIIRDRFPVPRLVVCDQHGSQARFLLAKLNPSATYNNANEIAAGSDIIFTDDVSLQVFIEHLQRLAVQS

cccccccccccccCEEEEcccccccHHHHHcccccEEEEEccccccccccccccccccccccccEEccccEEEccccEEECccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEEccccccccEEEEcccccccHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccccccccEEEEEEECccEEEEEEEcccccccccccccccccEEEEccccccEEEEEEEEccccccccccccccCEEEEEEEEEEcccccEEEEEEEEEcccccccccHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHccccHHHHHHHHcccEEEccccccccccccccccccccEEEEEEcccEEEEEEcccHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHcccccEEEEEccccccccHHHHcccccccccccccccccccEEEcccccHHHHHHHHHHHHHcc

******TDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKTCTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTLPHSM**********RLSPVFVFVLDTCMIEEELGYARSELKRAIGLLPDNAMVGLVTFGTQAHVHELGFSDMSKVYVFRGNKEISKDQVLEQLG*********************PNSGVSRFLLPASECEYTLNSLLDELQPDQWPVAPRTRPSRCTGVALSVATGLLGACLPGTGARIVALVGGPCTEGPGTIV****************DAAPFFKKAVKFYDGLAKQLVSQGHVLDLFASALDQVGVAEMKVAVEKTGGLVVLAESFGHSVFKDSFKRIFEDGEQSLGLCFNGALEIICSKDIKIQGIIGPCTSLEKVRLRGEYYAWKMCGLDKSTCLTVFFDLSSSERLNTPGTINPQLYLQFLTSFQSPEGRSVLRVTTVTRQWVDSAVSSEELVQGFDQESAAVVMARLTSLKMEMEEGFDATRWLDRSLIRLCSKFGDYRKDDPASFTLNPSFSLFPQFMFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLRAPHDDAELIIRDRFPVPRLVVCDQHGSQARFLLAKLNPSATYNNA***AAGSDIIFTDDVSLQVFIEHLQRLAV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein transport protein Sec23A	Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.	probable	Q7SZE5
Protein transport protein Sec23A	Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.	probable	Q5R9P3
Protein transport protein sec23	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.	probable	Q2URM9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NUT, chain A
Confidence level:very confident
Coverage over the Query: 5-211,236-466,479-727,749-766
View the alignment between query and template
View the model in PyMOL

Template: 2QTV, chain A
Confidence level:very confident
Coverage over the Query: 10-214,232-466,480-764
View the alignment between query and template
View the model in PyMOL